EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03119 - DNA_ligase_ZBD)
FAM  PF03119
PID  DNA_ligase_ZBD
DES  NAD-dependent DNA ligase C4 zinc finger domain
IPR  IPR004149
ANO  32
ALN  30
AID  0.464582
APH  (((((((((((DNLJ_AQUAE/436-463:0.08689,((DNLJ_MYCGE/396-423:0.00000,DNLJ_MYCPN/395-422:0.54184):0.47512,DNLJ_RHOMR/448-475:0.39395):0.15477):0.08531,DNLJ_SYNY3/405-432:0.38307):0.11918,DNLJ_THEMA/407-435:0.43064):0.05933,(DNLJ_CHLPN/402-429:0.05309,DNLJ_CHLTR/401-426:0.44262):0.58808):0.09456,((DNLJ_ZYMMO/432-460:0.27600,(DNLJ_ECOLI/406-434:0.11952,(DNLJ_HAEIN/416-444:0.23326,Q9RBF2_ALTHA/406-434:0.17718):0.01811):0.18619):0.30122,DNLJ_RICPR/411-439:0.55552):0.38171):0.09864,(DNLJ_BACSU/402-429:0.00000,Q99540_HUMAN/413-440:0.31027):0.12950):0.02255,DNLJ_BACST/401-428:0.06517):0.24453,((DNLJ_MYCLE/416-445:0.04650,DNLJ_MYCTU/416-445:0.06035):0.15406,DNLJ_STRCO/421-450:0.25859):0.37775):0.04490,(DNLJ_BORBU/394-419:0.60321,((DNLJ_THESK/407-432:0.00000,Q9ZFY7_THEAQ/356-381:0.04264):0.02628,(Q9ZFY2_9DEIN/322-347:0.00187,(((Q9ZFY3_9DEIN/353-378:0.00000,((Q9ZFY6_THETH/361-386:0.00000,Q9ZFY5_THEFI/350-375:0.00000):0.00000,DNLJ_THETH/410-435:0.00000):0.04382):0.00000,DNLJ_THEFI/407-432:0.00000):0.00000,DNLJ_THESC/407-432:0.00000):0.08704):0.06304):0.26312):0.32743):0.18401,Q9RSQ5_DEIRA/416-443:0.16390):0.64761,DNLJ_HELPY/398-423:0.00000,DNLJ_HELPJ/398-423:0.00000);
ATP  (((((((((((DNLJ_AQUAE/436-463,((DNLJ_MYCGE/396-423,DNLJ_MYCPN/395-422),DNLJ_RHOMR/448-475)),DNLJ_SYNY3/405-432),DNLJ_THEMA/407-435),(DNLJ_CHLPN/402-429,DNLJ_CHLTR/401-426)),((DNLJ_ZYMMO/432-460,(DNLJ_ECOLI/406-434,(DNLJ_HAEIN/416-444,Q9RBF2_ALTHA/406-434))),DNLJ_RICPR/411-439)),(DNLJ_BACSU/402-429,Q99540_HUMAN/413-440)),DNLJ_BACST/401-428),((DNLJ_MYCLE/416-445,DNLJ_MYCTU/416-445),DNLJ_STRCO/421-450)),(DNLJ_BORBU/394-419,((DNLJ_THESK/407-432,Q9ZFY7_THEAQ/356-381),(Q9ZFY2_9DEIN/322-347,(((Q9ZFY3_9DEIN/353-378,((Q9ZFY6_THETH/361-386,Q9ZFY5_THEFI/350-375),DNLJ_THETH/410-435)),DNLJ_THEFI/407-432),DNLJ_THESC/407-432))))),Q9RSQ5_DEIRA/416-443),DNLJ_HELPY/398-423,DNLJ_HELPJ/398-423);
ATL  10.4014
DNO  30
DLN  90
DID  0.492046
DPH  ((((((((DNLJ_SYNY3/405-432:0.44073,(DNLJ_THEMA/407-435:0.34890,DNLJ_AQUAE/436-463:0.16849):0.11041):0.09895,((DNLJ_BACSU/402-429:0.02667,(DNLJ_BACST/401-428:0.07711,((Q9RSQ5_DEIRA/416-443:0.26480,(((DNLJ_MYCLE/416-445:0.18565,DNLJ_MYCTU/416-445:0.00569):0.15187,DNLJ_STRCO/421-450:0.13195):0.13354,(((Q9ZFY3_9DEIN/353-378:0.00000,DNLJ_THESC/407-432:0.00000):0.11214,(((Q9ZFY6_THETH/361-386:0.01320,DNLJ_THETH/410-435:0.00000):0.04041,Q9ZFY7_THEAQ/356-381:0.00000):0.01318,DNLJ_THESK/407-432:0.00000):0.05114):0.04798,Q9ZFY2_9DEIN/322-347:0.00000):0.26865):0.05533):0.07779,DNLJ_RHOMR/448-475:0.42980):0.19619):0.19270):0.28005,Q99540_HUMAN/413-440:0.17267):0.20270):0.16596,(DNLJ_ZYMMO/432-460:0.34090,((DNLJ_HAEIN/416-444:0.29187,Q9RBF2_ALTHA/406-434:0.11684):0.11161,DNLJ_ECOLI/406-434:0.20954):0.09551):0.20338):0.00868,((DNLJ_MYCGE/396-423:0.09428,DNLJ_MYCPN/395-422:0.42011):0.19478,DNLJ_BORBU/394-419:0.46656):0.09026):0.05876,DNLJ_RICPR/411-439:0.37302):0.18529,DNLJ_CHLTR/401-426:0.31601):0.06636,DNLJ_CHLPN/402-429:0.20098):0.54591,DNLJ_HELPY/398-423:0.03850,DNLJ_HELPJ/398-423:0.04000);
DTP  ((((((((DNLJ_SYNY3/405-432,(DNLJ_THEMA/407-435,DNLJ_AQUAE/436-463)),((DNLJ_BACSU/402-429,(DNLJ_BACST/401-428,((Q9RSQ5_DEIRA/416-443,(((DNLJ_MYCLE/416-445,DNLJ_MYCTU/416-445),DNLJ_STRCO/421-450),(((Q9ZFY3_9DEIN/353-378,DNLJ_THESC/407-432),(((Q9ZFY6_THETH/361-386,DNLJ_THETH/410-435),Q9ZFY7_THEAQ/356-381),DNLJ_THESK/407-432)),Q9ZFY2_9DEIN/322-347))),DNLJ_RHOMR/448-475))),Q99540_HUMAN/413-440)),(DNLJ_ZYMMO/432-460,((DNLJ_HAEIN/416-444,Q9RBF2_ALTHA/406-434),DNLJ_ECOLI/406-434))),((DNLJ_MYCGE/396-423,DNLJ_MYCPN/395-422),DNLJ_BORBU/394-419)),DNLJ_RICPR/411-439),DNLJ_CHLTR/401-426),DNLJ_CHLPN/402-429),DNLJ_HELPY/398-423,DNLJ_HELPJ/398-423);
DTL  8.93379
RID  0.450868
RPH  (((((((((((DNLJ_AQUAE/436-463:0.08630,((DNLJ_MYCGE/396-423:0.00000,DNLJ_MYCPN/395-422:0.54795):0.48077,DNLJ_RHOMR/448-475:0.40032):0.15603):0.08956,DNLJ_SYNY3/405-432:0.38437):0.11856,DNLJ_THEMA/407-435:0.43529):0.06053,(DNLJ_CHLPN/402-429:0.05450,DNLJ_CHLTR/401-426:0.44527):0.59735):0.09514,((DNLJ_ZYMMO/432-460:0.27825,(DNLJ_ECOLI/406-434:0.11979,(DNLJ_HAEIN/416-444:0.23510,Q9RBF2_ALTHA/406-434:0.17771):0.01891):0.18712):0.30129,DNLJ_RICPR/411-439:0.56171):0.38665):0.09719,(DNLJ_BACSU/402-429:0.00000,Q99540_HUMAN/413-440:0.31258):0.13096):0.02184,DNLJ_BACST/401-428:0.06519):0.24262,((DNLJ_MYCLE/416-445:0.04684,DNLJ_MYCTU/416-445:0.06080):0.15819,DNLJ_STRCO/421-450:0.25800):0.38245):0.04815,(DNLJ_BORBU/394-419:0.61261,((DNLJ_THESK/407-432:0.00000,Q9ZFY7_THEAQ/356-381:0.04288):0.02605,(Q9ZFY2_9DEIN/322-347:0.00183,((Q9ZFY6_THETH/361-386:0.00000,DNLJ_THETH/410-435:0.00000):0.04408,(DNLJ_THESC/407-432:0.00000,Q9ZFY3_9DEIN/353-378:0.00000):0.00000):0.08754):0.06377):0.26074):0.33279):0.18262,Q9RSQ5_DEIRA/416-443:0.16582):0.65077,DNLJ_HELPY/398-423:0.00000,DNLJ_HELPJ/398-423:0.00000);
RTP  (((((((((((DNLJ_AQUAE/436-463,((DNLJ_MYCGE/396-423,DNLJ_MYCPN/395-422),DNLJ_RHOMR/448-475)),DNLJ_SYNY3/405-432),DNLJ_THEMA/407-435),(DNLJ_CHLPN/402-429,DNLJ_CHLTR/401-426)),((DNLJ_ZYMMO/432-460,(DNLJ_ECOLI/406-434,(DNLJ_HAEIN/416-444,Q9RBF2_ALTHA/406-434))),DNLJ_RICPR/411-439)),(DNLJ_BACSU/402-429,Q99540_HUMAN/413-440)),DNLJ_BACST/401-428),((DNLJ_MYCLE/416-445,DNLJ_MYCTU/416-445),DNLJ_STRCO/421-450)),(DNLJ_BORBU/394-419,((DNLJ_THESK/407-432,Q9ZFY7_THEAQ/356-381),(Q9ZFY2_9DEIN/322-347,((Q9ZFY6_THETH/361-386,DNLJ_THETH/410-435),(DNLJ_THESC/407-432,Q9ZFY3_9DEIN/353-378)))))),Q9RSQ5_DEIRA/416-443),DNLJ_HELPY/398-423,DNLJ_HELPJ/398-423);
RTL  10.4931
LNK  DNLJ_AQUAE/436-463:O66880:AE000699
LNK  DNLJ_BACST/401-428:O87703:AJ011676
LNK  DNLJ_BACSU/402-429:O31498:Z99107
LNK  DNLJ_BORBU/394-419:O51502:AE001157
LNK  DNLJ_CHLPN/402-429:Q9Z934:AE001601
LNK  DNLJ_CHLTR/401-426:O84148:AE001288
LNK  DNLJ_ECOLI/406-434:P15042:M30255
LNK  DNLJ_HAEIN/416-444:P43813:U32789
LNK  DNLJ_HELPJ/398-423:Q9ZLM1:AE001489
LNK  DNLJ_HELPY/398-423:O25336:AE000576
LNK  DNLJ_MYCGE/396-423:P47496:U39704
LNK  DNLJ_MYCLE/416-445:O33102:Z99263
LNK  DNLJ_MYCPN/395-422:P78021:AE000047
LNK  DNLJ_MYCTU/416-445:P63973:BX842581
LNK  DNLJ_RHOMR/448-475:P49421:U10483
LNK  DNLJ_RICPR/411-439:Q9ZCK9:AJ235273
LNK  DNLJ_STRCO/421-450:Q9Z585:AL939123
LNK  DNLJ_SYNY3/405-432:P72588:D90899
LNK  DNLJ_THEFI/407-432:Q9ZHI0:
LNK  DNLJ_THEMA/407-435:Q9WXV5:AE001696
LNK  DNLJ_THESC/407-432:P49422:Z29528
LNK  DNLJ_THESK/407-432:Q9ZFY8:AF092862
LNK  DNLJ_THETH/410-435:P26996:M36417
LNK  DNLJ_ZYMMO/432-460:P28719:Z11910
LNK  Q99540_HUMAN/413-440:Q99540:X98266
LNK  Q9RBF2_ALTHA/406-434:Q9RBF2:AF126866
LNK  Q9RSQ5_DEIRA/416-443:Q9RSQ5:AE002043
LNK  Q9ZFY2_9DEIN/322-347:Q9ZFY2:AF092868
LNK  Q9ZFY3_9DEIN/353-378:Q9ZFY3:AF092867
LNK  Q9ZFY5_THEFI/350-375:Q9ZFY5:
LNK  Q9ZFY6_THETH/361-386:Q9ZFY6:AF092864
LNK  Q9ZFY7_THEAQ/356-381:Q9ZFY7:AF092863
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9ZFY7_THEAQ/356-381
ASQ  ENCPECGHALLKE-G--KVHRCPNPL-CPA
DSQ  GAGAACTGCCCCGAGTGCGGCCACGCCCTCCTCAAGGAG---GGG------AAGGTCCACCGCTGCCCCAACCCCTTG---TGCCCCGCC
TRN  11011111111111111
NAM  DNLJ_THESK/407-432
ASQ  ENCPECGHALIKE-G--KVHRCPNPL-CPA
DSQ  GAGAACTGCCCCGAGTGCGGCCACGCCCTCATCAAGGAG---GGG------AAGGTCCACCGCTGCCCCAACCCCTTG---TGCCCCGCC
TRN  11011111111111111
NAM  Q9ZFY2_9DEIN/322-347
ASQ  ENCPECGHHLVKE-G--KVHRCPNPL-CPA
DSQ  GAGAACTGCCCGGAGTGCGGCCACCATCTGGTGAAGGAG---GGG------AAGGTCCACCGCTGCCCCAACCCCTTG---TGCCCCGCC
TRN  11011111101111111
NAM  DNLJ_THETH/410-435
ASQ  ETCPECGHRLLKE-G--KVHRCPNPL-CPA
DSQ  GAGACCTGCCCCGAGTGCGGCCACCGCCTCCTCAAGGAG---GGG------AAGGTCCACCGCTGCCCCAACCCCTTG---TGCCCCGCC
TRN  11011111111111111
NAM  Q9ZFY5_THEFI/350-375
ASQ  ETCPECGHRLLKE-G--KVHRCPNPL-CPA
NAM  Q9ZFY6_THETH/361-386
ASQ  ETCPECGHRLLKE-G--KVHRCPNPL-CPA
DSQ  GAGACCTGCCCCGAGTGCGGCCACCGCCTCCTCAAGGAG---GGG------AAGGTCCACCGGTGCCCCAACCCCTTG---TGCCCCGCC
TRN  11011111111111111
NAM  DNLJ_THEFI/407-432
ASQ  ETCPECGHRLVKE-G--KVHRCPNPL-CPA
NAM  DNLJ_THESC/407-432
ASQ  ETCPECGHRLVKE-G--KVHRCPNPL-CPA
DSQ  GAAACCTGTCCCGAGTGCGGCCACCGCCTGGTCAAGGAG---GGC------AAGGTGCACCGCTGCCCCAATCCCTTG---TGCCCGGCC
TRN  11011111101111111
NAM  Q9ZFY3_9DEIN/353-378
ASQ  ETCPECGHRLVKE-G--KVHRCPNPL-CPA
DSQ  GAAACCTGTCCCGAGTGCGGCCACCGCCTGGTCAAGGAG---GGC------AAGGTGCACCGCTGCCCCAATCCCTTG---TGCCCGGCC
TRN  11011111101111111
NAM  DNLJ_STRCO/421-450
ASQ  AECPECGTPLKAMKEGDIDLRCPNARACPA
DSQ  GCCGAGTGCCCCGAGTGCGGGACGCCGCTGAAGGCGATGAAGGAGGGCGACATCGACCTCCGCTGCCCCAACGCCCGCGCCTGCCCGGCC
TRN  11011111101111111
NAM  DNLJ_MYCTU/416-445
ASQ  TTCPECGSPLAPEKEGDADIRCPNARGCPG
DSQ  ACCACCTGCCCGGAGTGCGGTTCGCCGTTGGCGCCGGAGAAGGAAGGCGACGCCGACATCCGTTGCCCCAACGCCCGCGGCTGCCCGGGG
TRN  11111111111111111
NAM  DNLJ_MYCLE/416-445
ASQ  TTCPECGTTLAPEKEGDADIRCPNARSCPG
DSQ  ACAACGTGTCCCGAGTGCGGTACTACGTTAGCGCCAGAAAAGGAAGGCGATGCCGACATCCGTTGCCCCAATGCCAGGAGCTGCCCGGGG
TRN  10110101110011010
NAM  Q99540_HUMAN/413-440
ASQ  VACPACGSELVHI-SGEVALRCINPF-CAA
DSQ  GTTGCCTGTCCAGCGTGTGGGTCAGAATTAGTCCACATC---TCAGGCGAAGTGGCGTTACGTTGTATTAACCCTTTC---TGTGCGGCA
TRN  11111111111111100
NAM  DNLJ_BACSU/402-429
ASQ  TECPECGSELVRI-EGEVALRCINPE-CPA
DSQ  ACGGAATGTCCTGAATGCGGCAGTGAACTCGTCCGGATC---GAAGGAGAAGTGGCGCTTCGCTGCATTAACCCTGAA---TGTCCGGCG
TRN  11011111111111111
NAM  DNLJ_BACST/401-428
ASQ  THCPECESELVRL-EGEVALRCLNPN-CPA
DSQ  ACGCACTGCCCGGAATGCGAAAGCGAGCTCGTCCGTCTC---GAGGGGGAAGTGGCGCTCCGCTGCTTGAACCCGAAC---TGCCCGGCC
TRN  11011111111111111
NAM  DNLJ_AQUAE/436-463
ASQ  KYCPSCGSELVKL-PEEVAIRCINIS-CPA
DSQ  AAGTACTGTCCTTCCTGCGGTTCTGAGCTCGTAAAACTT---CCCGAGGAAGTAGCTATAAGGTGTATAAACATATCC---TGCCCCGCT
TRN  10010101110011011
NAM  DNLJ_THEMA/407-435
ASQ  DKCPVCGGKVGKLNPDEVAIRCLNPH-CPA
DSQ  GATAAGTGCCCTGTCTGTGGTGGGAAAGTAGGAAAGTTGAATCCCGACGAGGTTGCTATCAGGTGTCTAAACCCGCAT---TGTCCTGCT
TRN  10010101110011011
NAM  DNLJ_SYNY3/405-432
ASQ  SHCPACGSPLVRP-LEEAVIRCVNSS-CSA
DSQ  TCCCATTGCCCGGCCTGTGGTTCCCCCTTGGTCCGACCC---CTGGAAGAAGCTGTCATCCGTTGTGTCAATAGTTCC---TGCTCCGCT
TRN  11011111101111111
NAM  DNLJ_RHOMR/448-475
ASQ  ERCPSCGSQLVRL-PGEADYYCVASD-CPA
DSQ  GAGCGGTGTCCGTCGTGCGGCAGCCAGCTGGTGCGGCTG---CCCGGTGAGGCCGACTATTACTGTGTGGCGTCCGAC---TGCCCGGCG
TRN  11011111101111111
NAM  Q9RSQ5_DEIRA/416-443
ASQ  THCPVCGHEAVRA-EGDANTYCPNPA-CPA
DSQ  ACTCACTGTCCGGTCTGCGGGCACGAGGCGGTGCGTGCC---GAGGGCGACGCCAACACCTACTGCCCCAACCCCGCC---TGCCCCGCC
TRN  11111111111111111
NAM  DNLJ_HELPJ/398-423
ASQ  KVCPICSHELLCE-E--IFTYCQNLN-CPA
DSQ  AAAGTTTGCCCCATATGCTCGCATGAACTTTTATGCGAA---GAG------ATTTTTACCTATTGTCAAAACCTTAAT---TGCCCGGCA
TRN  10010101110011010
NAM  DNLJ_HELPY/398-423
ASQ  KVCPICSHELLCE-E--IFTYCQNLN-CPA
DSQ  AAGGTTTGCCCTATATGTTCGCATGAGCTTTTGTGCGAA---GAG------ATTTTTACTTATTGTCAAAACCTTAAT---TGCCCGGCA
TRN  10010111110111011
NAM  DNLJ_RICPR/411-439
ASQ  VFCPSCNSKLRYVSE-DIIIRCDNGLNCPA
DSQ  GTATTTTGTCCATCATGTAATTCTAAATTGCGTTATGTGTCTGAA---GATATTATTATACGCTGTGATAACGGTCTTAACTGTCCTGCT
TRN  10010101110011001
NAM  Q9RBF2_ALTHA/406-434
ASQ  TTCPICDSHVE-KVEGEAVARCTGGLVCPA
DSQ  ACGACTTGCCCAATCTGTGATTCTCATGTTGAA---AAGGTTGAAGGCGAAGCTGTAGCCCGGTGTACGGGTGGGCTTGTATGTCCTGCA
TRN  11011111111111111
NAM  DNLJ_ECOLI/406-434
ASQ  THCPVCGSDVE-RVEGEAVARCTGGLICGA
DSQ  ACGCATTGTCCGGTATGTGGTTCTGACGTTGAG---CGTGTGGAAGGTGAAGCGGTTGCCCGCTGTACCGGTGGCCTGATTTGCGGTGCG
TRN  11011111101111111
NAM  DNLJ_HAEIN/416-444
ASQ  TNCPVCDSQII-RIEGEAVARCTGGLFCAA
DSQ  ACAAATTGCCCTGTGTGCGATTCTCAAATTATT---CGTATTGAAGGCGAAGCAGTAGCACGTTGCACGGGAGGATTATTCTGTGCGGCA
TRN  11111111111111110
NAM  DNLJ_ZYMMO/432-460
ASQ  HRCPVCDSVAR-REEGEVAWRCTGGLICPA
DSQ  CATCGCTGTCCAGTTTGTGACTCTGTTGCTAGA---AGGGAAGAAGGGGAAGTCGCCTGGCGTTGCACCGGAGGTTTGATCTGTCCAGCG
TRN  10110101110011011
NAM  DNLJ_CHLTR/401-426
ASQ  SLCPVCHEPVVKE-K--VSVRCVNPL-CSG
DSQ  AGCCTGTGTCCTGTATGTCATGAACCTGTTGTTAAAGAG---AAG------GTGTCGGTGCGTTGTGTCAATCCACTT---TGTTCAGGG
TRN  11011101101011001
NAM  DNLJ_CHLPN/402-429
ASQ  EFCPVCHSHVVRE-EDRVSVRCVNPE-CVA
DSQ  GAATTCTGCCCTGTCTGCCATAGTCACGTAGTTCGGGAA---GAAGATAGAGTTTCTGTGCGTTGTGTCAATCCTGAG---TGTGTTGCA
TRN  10110101110011011
NAM  DNLJ_BORBU/394-419
ASQ  DNCPACKTAVVKE-G--AHFFCPNNN-CPS
DSQ  GATAATTGCCCAGCTTGTAAAACGGCTGTAGTAAAAGAG---GGG------GCACATTTTTTTTGTCCAAATAATAAT---TGTCCTTCA
TRN  11111101111011001
NAM  DNLJ_MYCPN/395-422
ASQ  THCPACQAPLVQY-KDEVDQYCTNER-CDQ
DSQ  ACCCACTGTCCGGCATGTCAAGCCCCGTTAGTGCAGTAT---AAGGATGAGGTAGATCAGTACTGTACCAATGAACGT---TGTGACCAG
TRN  11111111111111110
NAM  DNLJ_MYCGE/396-423
ASQ  KYCPSCNSKLVKI-VDEVDQYCTNET-CKE
DSQ  AAATATTGTCCTTCATGTAATTCAAAACTAGTCAAAATA---GTTGATGAAGTTGATCAGTATTGTACCAATGAAACT---TGTAAGGAG
TRN  10010101110011001
//