EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03118 - RNA_pol_A_CTD)
FAM  PF03118
PID  RNA_pol_A_CTD
DES  Bacterial RNA polymerase, alpha chain C terminal domain
IPR  IPR011260
ANO  14
ALN  68
AID  0.365055
APH  (((((RPOA_CHLTR/272-339:0.59453,RPOA_SHESP/241-308:0.63783):0.29021,RPOA_MYCTU/236-303:0.33424):0.17710,(((RPOA_ODOSI/237-304:0.47323,RPOA_SYNP6/232-298:0.29982):0.12502,RPOA_CYAPA/232-299:0.16847):0.15718,(RPOA_MARPO/260-327:0.22376,(RPOA_PINTH/259-326:0.17517,(RPOA_PEA/262-328:0.22413,RPOA_AGRCR/259-326:0.33212):0.31798):0.20320):0.36973):0.35335):0.06955,(RPOA_MYCGE/254-321:0.43590,RPOA_BACSU/238-305:0.33803):0.06890):0.13047,RPOA_MYCSP/255-322:0.71126,RPOA_HELPY/246-313:0.87024);
ATP  (((((RPOA_CHLTR/272-339,RPOA_SHESP/241-308),RPOA_MYCTU/236-303),(((RPOA_ODOSI/237-304,RPOA_SYNP6/232-298),RPOA_CYAPA/232-299),(RPOA_MARPO/260-327,(RPOA_PINTH/259-326,(RPOA_PEA/262-328,RPOA_AGRCR/259-326))))),(RPOA_MYCGE/254-321,RPOA_BACSU/238-305)),RPOA_MYCSP/255-322,RPOA_HELPY/246-313);
ATL  8.08142
DNO  14
DLN  204
DID  0.487256
DPH  ((((((((((RPOA_SHESP/241-308:0.49785,RPOA_MYCTU/236-303:0.33642):0.11544,RPOA_CHLTR/272-339:0.49102):0.05477,RPOA_HELPY/246-313:0.59780):0.09095,RPOA_MYCGE/254-321:0.40113):0.10211,RPOA_BACSU/238-305:0.26053):0.13674,RPOA_MYCSP/255-322:0.41265):0.11487,(RPOA_CYAPA/232-299:0.16177,(RPOA_SYNP6/232-298:0.45233,RPOA_ODOSI/237-304:0.23390):0.09965):0.08592):0.25615,RPOA_MARPO/260-327:0.14329):0.15297,RPOA_PINTH/259-326:0.14227):0.17514,RPOA_AGRCR/259-326:0.14773,RPOA_PEA/262-328:0.13272);
DTP  ((((((((((RPOA_SHESP/241-308,RPOA_MYCTU/236-303),RPOA_CHLTR/272-339),RPOA_HELPY/246-313),RPOA_MYCGE/254-321),RPOA_BACSU/238-305),RPOA_MYCSP/255-322),(RPOA_CYAPA/232-299,(RPOA_SYNP6/232-298,RPOA_ODOSI/237-304))),RPOA_MARPO/260-327),RPOA_PINTH/259-326),RPOA_AGRCR/259-326,RPOA_PEA/262-328);
DTL  5.79612
RID  0.365055
RPH  (((((RPOA_CHLTR/272-339:0.59453,RPOA_SHESP/241-308:0.63783):0.29021,RPOA_MYCTU/236-303:0.33424):0.17710,(((RPOA_ODOSI/237-304:0.47323,RPOA_SYNP6/232-298:0.29982):0.12502,RPOA_CYAPA/232-299:0.16847):0.15718,(RPOA_MARPO/260-327:0.22376,(RPOA_PINTH/259-326:0.17517,(RPOA_PEA/262-328:0.22413,RPOA_AGRCR/259-326:0.33212):0.31798):0.20320):0.36973):0.35335):0.06955,(RPOA_MYCGE/254-321:0.43590,RPOA_BACSU/238-305:0.33803):0.06890):0.13047,RPOA_MYCSP/255-322:0.71126,RPOA_HELPY/246-313:0.87024);
RTP  (((((RPOA_CHLTR/272-339,RPOA_SHESP/241-308),RPOA_MYCTU/236-303),(((RPOA_ODOSI/237-304,RPOA_SYNP6/232-298),RPOA_CYAPA/232-299),(RPOA_MARPO/260-327,(RPOA_PINTH/259-326,(RPOA_PEA/262-328,RPOA_AGRCR/259-326))))),(RPOA_MYCGE/254-321,RPOA_BACSU/238-305)),RPOA_MYCSP/255-322,RPOA_HELPY/246-313);
RTL  8.08142
LNK  RPOA_AGRCR/259-326:P92209:Z77771
LNK  RPOA_BACSU/238-305:P20429:M26414
LNK  RPOA_CHLTR/272-339:Q46449:AE001323
LNK  RPOA_CYAPA/232-299:P48118:U30821
LNK  RPOA_HELPY/246-313:P56001:AE000633
LNK  RPOA_MARPO/260-327:P06270:X04465
LNK  RPOA_MYCGE/254-321:P47423:U39697
LNK  RPOA_MYCSP/255-322:P38018:L09636
LNK  RPOA_MYCTU/236-303:P66701:BX842583
LNK  RPOA_ODOSI/237-304:P49465:Z67753
LNK  RPOA_PEA/262-328:P13911:X15645
LNK  RPOA_PINTH/259-326:P41629:D17510
LNK  RPOA_SHESP/241-308:P74963:D83194
LNK  RPOA_SYNP6/232-298:O24710:AB000111
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RPOA_HELPY/246-313
ASQ  GDYAQRDDAKDLSAKIESMNLSARCFNCLDKIGIKYVGELVLMSEEELKGVKNMGKKSYDEIAEKLND
DSQ  GGCGATTACGCTCAAAGAGATGACGCTAAAGACTTGAGCGCTAAGATTGAAAGCATGAATTTGAGCGCTAGGTGTTTTAATTGCTTGGATAAAATCGGCATCAAGTATGTGGGCGAACTCGTGTTGATGAGCGAAGAAGAGCTTAAGGGCGTGAAAAACATGGGTAAAAAATCCTATGATGAAATCGCTGAAAAATTGAATGAT
TRN  10010101110011011
NAM  RPOA_MYCSP/255-322
ASQ  ENKEKKEREIKSTTPITKLGLSVRSENALRRAKYNTVEEVLGLSDEELSNIKNLGKKSIQDIIEKRNE
DSQ  GAAAATAAAGAAAAGAAAGAAAGAGAAATTAAGTCTACAACCCCAATTACTAAATTAGGTTTATCTGTAAGATCTGAAAATGCTTTAAGAAGAGCTAAATATAATACTGTAGAAGAAGTTTTAGGCTTAAGCGACGAAGAATTATCTAATATTAAAAACTTGGGTAAAAAATCAATTCAAGATATTATTGAAAAAAGAAATGAA
TRN  10110101110011000
NAM  RPOA_MYCGE/254-321
ASQ  QEKAEERKVKSFAKQIEELDFTVRTFNCLKRSGIHTLQELLSKSLTDIREIRNLGKKSEREIIKKVQE
DSQ  CAAGAGAAAGCAGAGGAAAGAAAGGTGAAATCATTTGCCAAGCAAATTGAAGAACTTGACTTTACTGTTAGAACCTTTAACTGTTTGAAAAGAAGTGGGATCCACACACTCCAAGAGTTACTATCAAAGTCATTAACTGACATTAGAGAGATTAGAAACCTAGGTAAGAAATCAGAACGGGAGATTATCAAAAAGGTGCAAGAG
TRN  10010101110011000
NAM  RPOA_BACSU/238-305
ASQ  VEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKTEEDMMKVRNLGRKSLEEVKAKLEE
DSQ  GTTGAAAAAGAAGAAGATCAAAAAGAGAAAGTTCTTGAAATGACAATTGAAGAATTGGATCTTTCTGTTCGTTCTTACAACTGCTTAAAGCGTGCGGGTATTAACACGGTTCAAGAGCTTGCGAACAAGACGGAAGAAGATATGATGAAAGTTCGAAATCTAGGACGCAAATCACTTGAAGAAGTGAAAGCGAAACTAGAAGAA
TRN  11011101111011000
NAM  RPOA_MYCTU/236-303
ASQ  PSPAEADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQ
DSQ  CCGTCGCCGGCCGAGGCCGATCACATTGCGTCATTCGCCCTGCCGATCGACGACCTGGATCTGACGGTGCGGTCCTACAACTGCCTCAAGCGCGAGGGGGTGCACACCGTGGGCGAACTGGTGGCGCGCACCGAATCCGACCTGCTTGACATCCGCAACTTCGGTCAGAAGTCCATCGACGAGGTGAAGATCAAGCTGCACCAG
TRN  11011111101111101
NAM  RPOA_ODOSI/237-304
ASQ  NKTLSAPKNPHTNIAIEELHLSVRAYNCLKRAQINTIGDLLKYSPEKLQELKNFGRKSADEVFTTLKN
DSQ  AATAAAACTTTATCAGCTCCAAAAAATCCACATACAAATATTGCAATTGAAGAATTGCATTTATCTGTACGAGCTTATAATTGTTTAAAACGAGCACAAATAAATACAATAGGTGATTTATTAAAATATTCCCCTGAAAAATTGCAGGAACTTAAAAACTTTGGCCGAAAATCTGCAGATGAAGTTTTTACCACTCTAAAAAAT
TRN  10010101110011000
NAM  RPOA_SYNP6/232-298
ASQ  HTADPEP-TPESQTPIEDLQLSVRAYNCLKRAQVNSVADLLSYTYEDLLEIKNFGQKSAEEVVEALER
DSQ  CACACCGCCGATCCTGAGCCC---ACGCCCGAAAGCCAAACGCCGATCGAAGATCTGCAGCTTTCGGTTCGGGCTTACAACTGCCTGAAGCGGGCGCAAGTGAACTCCGTTGCTGACTTGCTGAGCTACACCTACGAAGATCTACTGGAGATCAAAAACTTCGGCCAGAAATCGGCTGAAGAGGTGGTCGAAGCTCTCGAGCGC
TRN  11011101101011011
NAM  RPOA_CYAPA/232-299
ASQ  DDSTEQTEDKISQIPIEELQLSVRAYNCLKRAQIHSIGDLLNVSQEELLEIRNFGQKSAKEVIDALQK
DSQ  GATGATTCAACGGAACAAACAGAAGACAAAATAAGTCAAATTCCAATTGAGGAATTACAATTATCTGTTCGAGCGTATAATTGTTTAAAAAGAGCCCAAATTCATTCAATTGGCGATTTATTAAATGTTTCTCAAGAAGAATTACTAGAAATTCGTAATTTCGGTCAAAAATCAGCTAAAGAAGTTATTGATGCTTTACAAAAA
TRN  10010101110011000
NAM  RPOA_CHLTR/272-339
ASQ  EKENKDDILHKLVLGINEIELSVRSTNCLSNANIETIGELVIMPEPRLLQFRNFGKKSLCEIKNKLKE
DSQ  GAGAAAGAAAACAAAGACGATATTCTTCATAAATTGGTTTTAGGCATTAATGAGATAGAACTTTCTGTACGATCTACAAATTGTTTATCTAATGCCAATATCGAAACGATAGGGGAATTGGTAATTATGCCAGAGCCTCGTCTGTTACAATTTAGAAATTTCGGGAAGAAGTCTCTCTGCGAGATTAAGAATAAACTGAAAGAA
TRN  10010101100011010
NAM  RPOA_SHESP/241-308
ASQ  QKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLAS
DSQ  CAGAAAGAAGAGAAGCCAGAGTTCGATCCGATACTGCTACGTCCTGTTGATGATTTAGAACTTACTGTTCGTTCAGCTAACTGCCTAAAAGCAGAAGCTATTCACTATATTGGTGATCTTGTTCAGCGTACTGAGGTTGAGTTACTTAAAACACCTAACCTTGGTAAGAAATCTTTAACTGAAATTAAAGATGTTCTAGCTTCA
TRN  10010101100011000
NAM  RPOA_MARPO/260-327
ASQ  DIEKMTKDVAFKHIFIDQLELPARAYNCLKKVNVHTIADLLHYSEDDLIKIKNFGKKSVEQVLEALKK
DSQ  GATATTGAAAAAATGACCAAAGATGTTGCTTTTAAACATATATTTATTGATCAACTAGAATTACCTGCCAGAGCATATAATTGTCTTAAAAAAGTAAATGTGCATACAATAGCAGATTTATTACACTATAGTGAAGATGATTTAATTAAAATTAAAAATTTTGGAAAAAAATCAGTAGAACAAGTTTTGGAAGCATTAAAAAAA
TRN  10010101110011000
NAM  RPOA_PINTH/259-326
ASQ  DTGETKEKIAFQLIFIDQLELPPKTYNSLRRANIHTLLDLLNYSREDLMRIEHFGKESVEQVLEVLQK
DSQ  GATACGGGGGAAACGAAAGAAAAAATAGCATTTCAACTTATTTTCATTGACCAATTAGAGTTACCCCCCAAAACCTATAACTCCCTCAGAAGAGCCAATATACATACATTATTGGACCTCTTAAATTACAGTCGAGAAGATCTAATGAGAATTGAACACTTCGGGAAGGAATCTGTCGAACAGGTATTGGAAGTTCTACAAAAA
TRN  10010101110011010
NAM  RPOA_PEA/262-328
ASQ  KLRKNQKEITLKSIFIDQLELPPRIYNCLKKSNIHTVLELLNKSQEDLMKIEHFRVEDLKFILNILQ-
DSQ  AAACTAAGGAAAAATCAAAAAGAAATTACATTGAAATCCATTTTTATTGACCAATTAGAATTGCCTCCCCGGATCTATAATTGTCTTAAAAAGTCCAATATACATACAGTATTGGAACTTTTGAATAAGAGTCAAGAAGACCTTATGAAAATTGAACATTTTCGAGTAGAAGATTTAAAATTTATATTAAACATTTTACAA---
TRN  10010101110011010
NAM  RPOA_AGRCR/259-326
ASQ  NLKKNKKGIPLNCIFIDQLELTSRTYNCLKRANIHTLLDLLSKTEEDLLRIDSFRMEDRKHIWDTLEK
DSQ  AATCTAAAGAAAAACAAAAAAGGAATTCCATTGAATTGTATTTTTATTGATCAATTAGAATTGACTTCTAGAACGTATAATTGTCTAAAAAGGGCCAATATACATACACTATTGGACCTTTTGAGTAAGACTGAAGAAGATCTTCTGAGAATTGACAGTTTTCGTATGGAAGATAGAAAACATATATGGGACACTCTAGAGAAG
TRN  10010101100011010
//