EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03039 - IL12)
FAM  PF03039
PID  IL12
DES  Interleukin-12 alpha subunit
IPR  IPR004281
ANO  3
ALN  226
AID  0.609999
APH  (IL12A_MOUSE/1-215:0.40055,IL12A_MARMO/1-223:0.36822,IL12A_PIG/1-222:0.14627);
ATP  (IL12A_MOUSE/1-215,IL12A_MARMO/1-223,IL12A_PIG/1-222);
ATL  0.91504
DNO  2
DLN  678
DID  0.660465
DPH  (IL12A_MOUSE/1-215:0.40905,IL12A_MARMO/1-223:0.05444);
DTP  (IL12A_MOUSE/1-215,IL12A_MARMO/1-223);
DTL  0.4635
RID  0.548718
RPH  (IL12A_MOUSE/1-215:0.62067,IL12A_MARMO/1-223:0.11106);
RTP  (IL12A_MOUSE/1-215,IL12A_MARMO/1-223);
RTL  0.73172
LNK  IL12A_MARMO/1-223:Q61728:X97018
LNK  IL12A_MOUSE/1-215:P43431:M86672
LNK  IL12A_PIG/1-222:Q29053:
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  IL12A_MOUSE/1-215
ASQ  MCQ-SRYLLFLATLALLN---HLSLARVIPVS--GP---ARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPP--VGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA
DSQ  ATGTGTCAA---TCACGCTACCTCCTCTTTTTGGCCACCCTTGCCCTCCTAAAC---------CACCTCAGTTTGGCCAGGGTCATTCCAGTCTCT------GGACCT---------GCCAGGTGTCTTAGCCAGTCCCGAAACCTGCTGAAGACCACAGATGACATGGTGAAGACGGCCAGAGAAAAACTGAAACATTATTCCTGCACTGCTGAAGACATCGATCATGAAGACATCACACGGGACCAAACCAGCACATTGAAGACCTGTTTACCACTGGAACTACACAAGAACGAGAGTTGCCTGGCTACTAGAGAGACTTCTTCCACAACAAGAGGGAGCTGCCTGCCCCCACAGAAGACGTCTTTGATGATGACCCTGTGCCTTGGTAGCATCTATGAGGACTTGAAGATGTACCAGACAGAGTTCCAGGCCATCAACGCAGCACTTCAGAATCACAACCATCAGCAGATCATTCTAGACAAGGGCATGCTGGTGGCCATCGATGAGCTGATGCAGTCTCTGAATCATAATGGCGAGACTCTGCGCCAGAAACCTCCT------GTGGGAGAAGCAGACCCTTACAGAGTGAAAATGAAGCTCTGCATCCTGCTTCACGCCTTCAGCACCCGCGTCGTGACCATCAACAGGGTGATGGGCTATCTGAGCTCCGCC
TRN  10010101100011000
NAM  IL12A_MARMO/1-223
ASQ  MCPSARSLLLLASLVLLE---HLGSARNLPRSTPVPAVSQECHNLSQTLLSTVDSALQNAIEILEYYPCSAEEVNHEDITKNRTNTVKACLPQELAQNENCLASRETSFIIKRSSLTSGRTSWNTTLCFSSIYEDLKMYQLELKAISEKLLMDPKGQIYEDKALLAAVDYLMQAVNVNNETVPQTPSPEAPSSNLYRTKTKLCILLHALRIRAVTINRVMSYLNSS
DSQ  ATGTGTCCATCAGCGCGCAGCCTCCTTCTCCTGGCCTCCCTTGTCCTCCTGGAG---------CATCTTGGTTCTGCCAGGAACCTCCCCAGGAGCACCCCAGTCCCAGCAGTGTCCCAGGAGTGCCACAACCTCTCCCAAACCCTGCTGAGCACTGTGGACAGTGCCCTACAGAACGCCATAGAAATCCTAGAGTATTATCCCTGCAGTGCTGAAGAGGTCAATCATGAAGATATCACCAAGAACAGAACCAACACAGTGAAGGCCTGCTTGCCCCAGGAACTAGCCCAGAATGAAAACTGCCTGGCTTCCAGAGAGACCTCTTTTATAATTAAGAGGAGCAGCCTGACCTCGGGGAGGACCTCCTGGAATACGACGCTGTGCTTTAGTAGTATCTATGAGGACTTGAAGATGTACCAGCTGGAGCTCAAGGCCATCAGTGAAAAGCTGTTGATGGATCCTAAGGGGCAGATCTATGAAGATAAAGCCCTGCTGGCTGCTGTGGATTACCTGATGCAGGCCGTGAATGTCAACAATGAGACTGTGCCTCAGACACCTTCCCCTGAAGCACCTTCCTCTAATTTGTATAGAACGAAAACCAAGCTCTGCATACTTCTTCATGCTCTGCGAATCCGGGCGGTGACCATCAACAGGGTGATGAGCTATCTGAATTCTTCT
TRN  10010101100011001
NAM  IL12A_PIG/1-222
ASQ  MCP-LRNLLLVATLVLLNHLDHLSLGRSLPATTAGPGM-FKCLNHSQNLLKAVSNTLQKAKQTLEFYSCTSEEIDHEDITKDKTSTVEACLPLELATNESCLAARETSLITNGNCLTSGKTSFMTTLCLSSIYEDLKMYHVEFQAMNAKLLMDPKRQIFLDQNMLTAITELMQALNFNSETVPQKPS--LEELDFYKTKIKLCILLHAFRIRAVTIDRMMSYLNSS
//