EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03037 - KMP11)
FAM  PF03037
PID  KMP11
DES  Kinetoplastid membrane protein 11
IPR  IPR004132
ANO  4
ALN  90
AID  0.88577
APH  ((KM11_TRYCR/1-90:0.02331,KM11_TRYBB/1-90:0.03452):0.07318,Q9XZH5_LEIBR/1-90:0.05119,KM11_LEITR/1-90:0.07494);
ATP  ((KM11_TRYCR/1-90,KM11_TRYBB/1-90),Q9XZH5_LEIBR/1-90,KM11_LEITR/1-90);
ATL  0.25713
DNO  4
DLN  270
DID  0.833951
DPH  ((Q9XZH5_LEIBR/1-90:0.01314,KM11_LEITR/1-90:0.07845):0.10027,KM11_TRYCR/1-90:0.11103,KM11_TRYBB/1-90:0.07151);
DTP  ((Q9XZH5_LEIBR/1-90,KM11_LEITR/1-90),KM11_TRYCR/1-90,KM11_TRYBB/1-90);
DTL  0.37441
RID  0.88577
RPH  ((KM11_TRYCR/1-90:0.02331,KM11_TRYBB/1-90:0.03452):0.07318,Q9XZH5_LEIBR/1-90:0.05119,KM11_LEITR/1-90:0.07494);
RTP  ((KM11_TRYCR/1-90,KM11_TRYBB/1-90),Q9XZH5_LEIBR/1-90,KM11_LEITR/1-90);
RTL  0.25713
LNK  KM11_LEITR/1-90:O21436:AJ000078
LNK  KM11_TRYBB/1-90:Q26773:X96439
LNK  KM11_TRYCR/1-90:Q9U6Z1:AJ000077
LNK  Q9XZH5_LEIBR/1-90:Q9XZH5:AF142990
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  KM11_TRYBB/1-90
ASQ  MATTYEEFAAKLDRLDAEFAKKMEEQNKRFFADKPDEATLSPEMKEHYEKFEKMIQEHTDKFNKKMREHSEHFKAKFAELLEQQKNAQFP
DSQ  ATGGCCACCACATACGAAGAATTTGCTGCGAAGCTCGACCGCCTCGATGCCGAATTCGCCAAGAAGATGGAGGAGCAGAACAAGCGATTCTTCGCTGACAAGCCTGATGAGGCTACGCTGTCCCCTGAGATGAAAGAGCACTATGAAAAGTTCGAAAAAATGATCCAGGAGCACACGGACAAGTTCAACAAGAAGATGCGCGAGCACTCAGAGCACTTCAAGGCCAAGTTTGCGGAACTCCTCGAGCAGCAGAAGAATGCCCAGTTCCCC
TRN  11011101101011001
NAM  KM11_TRYCR/1-90
ASQ  MATTLEEFSAKLDRLDAEFAKKMEEQNKKFFADKPDESTLSPEMKEHYEKFEKMIQEHTDKFNKKMHEHSEHFKAKFAELLEQQKNAQFP
DSQ  ATGGCCACCACTCTTGAGGAATTCTCCGCCAAGCTTGACCGCCTGGACGCCGAGTTCGCGAAGAAGATGGAGGAACAGAACAAGAAGTTCTTCGCGGACAAACCCGACGAGAGCACGCTCTCCCCTGAAATGAAGGAGCACTATGAAAAGTTTGAAAAAATGATTCAGGAGCACACCGACAAATTCAACAAAAAGATGCACGAGCACTCTGAGCACTTCAAGGCCAAATTTGCTGAGTTGCTTGAGCAGCAGAAGAACGCCCAGTTCCCA
TRN  11011101101011011
NAM  Q9XZH5_LEIBR/1-90
ASQ  MATTYEDFAGKLDRLDDEFNKKMQEQNAKFFADKPDDSTLSPEMKEHYEKFEKMIQEHTDKFNKKMREHSEHFKQKFAELLEQQKNAQYP
DSQ  ATGGCCACCACCTACGAGGACTTTGCGGGGAAGCTGGACCGCCTGGATGACGAGTTCAACAAGAAGATGCAGGAGCAGAACGCGAAGTTCTTCGCGGACAAGCCGGACGACTCCACGCTGTCGCCCGAGATGAAGGAGCACTACGAGAAGTTCGAGAAGATGATCCAGGAGCACACGGACAAGTTCAACAAGAAGATGCGCGAGCACTCGGAGCACTTCAAGCAGAAGTTTGCTGAGCTGCTGGAGCAGCAGAAGAACGCGCAGTACCCG
TRN  11011111101111111
NAM  KM11_LEITR/1-90
ASQ  MATTYEEFSAKLDRLDEEFNRKMQEQNAKFFADKPDESTLSPEMKEHYEKFERMIKEHTEKFNKKMHEHSEHFKQKFAELLEQQKAAQYP
DSQ  ATGGCCACCACGTACGAGGAGTTTTCGGCGAAGCTGGACCGCCTGGATGAGGAGTTCAACAGGAAGATGCAGGAGCAGAACGCCAAGTTCTTTGCGGACAAGCCGGATGAGTCGACGCTGTCGCCCGAGATGAAGGAGCACTACGAGAAGTTCGAGCGCATGATCAAGGAGCACACAGAGAAGTTCAACAAGAAGATGCACGAGCACTCGGAGCACTTCAAGCAGAAGTTCGCCGAGCTGCTGGAGCAGCAGAAGGCTGCGCAGTACCCG
TRN  10010101100011011
//