EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02962 - CHMI)
FAM  PF02962
PID  CHMI
DES  5-carboxymethyl-2-hydroxymuconate isomerase
IPR  IPR004220
ANO  3
ALN  126
AID  0.540141
APH  (Q9RYT1_DEIRA/2-126:0.88606,Q9RE14_KLEPN/2-125:0.08823,HPCD_ECOLI/1-124:0.15973);
ATP  (Q9RYT1_DEIRA/2-126,Q9RE14_KLEPN/2-125,HPCD_ECOLI/1-124);
ATL  1.13402
DNO  3
DLN  378
DID  0.609436
DPH  (Q9RYT1_DEIRA/2-126:0.66246,Q9RE14_KLEPN/2-125:0.08903,HPCD_ECOLI/1-124:0.16327);
DTP  (Q9RYT1_DEIRA/2-126,Q9RE14_KLEPN/2-125,HPCD_ECOLI/1-124);
DTL  0.91476
RID  0.540141
RPH  (Q9RYT1_DEIRA/2-126:0.88606,Q9RE14_KLEPN/2-125:0.08823,HPCD_ECOLI/1-124:0.15973);
RTP  (Q9RYT1_DEIRA/2-126,Q9RE14_KLEPN/2-125,HPCD_ECOLI/1-124);
RTL  1.13402
LNK  HPCD_ECOLI/1-124:Q05354:X53666
LNK  Q9RE14_KLEPN/2-125:Q9RE14:AJ000054
LNK  Q9RYT1_DEIRA/2-126:Q9RYT1:AE001863
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9RYT1_DEIRA/2-126
ASQ  PHLTLEYTDNLPEP-RIPELLQKLNGVLLARPDIFPVGGIRARAYRLSEYALADSSEPSDAFVHLRLQIGAGRSEEVKKETGDALFAVLTDHFAAEFAQRGLMLSAEISEFSEAGTWKKNNIHARY
DSQ  CCCCATCTCACCCTCGAATACACCGACAACCTGCCCGAGCCG---CGCATTCCTGAGTTGCTGCAAAAGCTCAACGGCGTGTTGCTCGCCCGGCCCGACATCTTCCCCGTCGGCGGCATCCGGGCGCGGGCGTATCGCCTCAGCGAATATGCGCTGGCGGACAGCAGCGAACCGTCCGACGCGTTCGTGCACCTGCGACTGCAAATTGGCGCGGGCCGCAGCGAAGAGGTTAAAAAGGAGACGGGAGATGCCCTCTTTGCCGTTCTAACCGACCATTTTGCCGCCGAGTTCGCCCAGCGCGGGCTGATGCTCTCGGCGGAAATCAGCGAGTTCAGCGAGGCCGGGACGTGGAAGAAAAACAATATTCACGCGCGGTAC
TRN  11011101101011011
NAM  Q9RE14_KLEPN/2-125
ASQ  PHFFAECTDKIREQGDLPDLFSKVKDALAAS-GIFPIGGICSRAHWLDTWQMADGQH-DYAFVHMTLKIGAGRSLESRQDVGDMLFTLIKAHFAALMESRYLALSFELDELHPTLNYKQNNVHALF
DSQ  CCGCATTTTTTTGCTGAATGTACCGACAAAATCCGGGAACAGGGTGATTTACCGGATTTGTTCAGCAAAGTGAAAGACGCGCTGGCGGCGTCC---GGCATTTTTCCCATCGGCGGCATTTGCAGCCGCGCGCATTGGCTGGATACCTGGCAGATGGCCGACGGCCAGCAT---GATTATGCCTTTGTGCATATGACGCTGAAGATTGGCGCCGGGCGCAGCCTGGAGAGCCGCCAGGACGTGGGCGATATGCTGTTCACGCTGATCAAAGCCCATTTCGCCGCGCTAATGGAGAGCCGCTACCTGGCGCTGTCGTTTGAGCTCGATGAACTGCACCCGACGCTGAACTACAAGCAGAACAACGTGCACGCCTTGTTT
TRN  11011101101011010
NAM  HPCD_ECOLI/1-124
ASQ  PHFIVECSDNIREEADLPGLFAKVNPTLAAT-GIFPLAGIRSRVHWVDTWQMADGQH-DYASVHMTLKIGAGRSLESRQQAGEMLFELIKTHFAALMESRLLALSFEIEELHPTLNFKQNNVHALF
DSQ  CCGCACTTTATCGTTGAATGCAGTGATAACATCCGCGAAGAAGCCGACCTGCCGGGGTTGTTCGCCAAAGTGAATCCGACGCTGGCAGCCACG---GGTATTTTTCCGCTGGCGGGTATTCGCAGCCGCGTGCATTGGGTCGATACCTGGCAGATGGCCGACGGGCAGCAT---GATTATGCCTCCGTGCATATGACGTTGAAAATCGGCGCAGGTCGCAGCCTGGAAAGCCGCCAGCAGGCGGGTGAAATGCTGTTTGAACTGATTAAAACGCACTTCGCCGCCCTGATGGAGAGCCGCCTGCTGGCGTTGTCGTTTGAGATTGAAGAGCTGCATCCGACGCTGAATTTTAAACAAAACAACGTGCACGCATTGTTT
TRN  11011101101011011
//