EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02953 - zf-Tim10_DDP)
FAM  PF02953
PID  zf-Tim10_DDP
DES  Tim10/DDP family zinc finger
IPR  IPR004217
ANO  22
ALN  67
AID  0.292611
APH  ((((((((IM08_NEUCR/20-86:0.83591,IM08_SCHPO/21-85:0.43433):0.19419,((Q9Y0V8_CAEEL/12-78:0.86891,IM8A_HUMAN/20-84:0.25381):0.28464,(IM8B_HUMAN/15-77:0.38520,IM08_DROME/17-79:0.21011):0.24999):0.07277):0.35948,IM08_ARATH/12-77:0.42148):0.22497,(((IM13A_RAT/23-87:0.25388,((IM13_CAEEL/22-86:0.08398,IM13_BRUMA/22-86:0.22710):0.49345,IM13_DROME/12-76:0.08311):0.09793):0.11992,(IM13_YEAST/34-95:0.61348,IM13_SCHPO/22-86:0.20045):0.14442):0.12395,(IM13_ARATH/22-86:0.13044,IM13_ORYSA/18-82:0.20954):0.37834):0.34237):0.54651,(IM9A_CAEEL/1-66:0.73093,(IM09_ORYSA/20-85:0.35103,IM09_YEAST/12-77:0.38625):0.08820):0.72652):0.82771,IM10_YEAST/17-83:0.01930):0.35525,Q9UTE9_SCHPO/16-82:0.33501):0.29514,Q9Y0V6_CAEEL/6-72:0.28226,Q9Y0V5_CIOIN/6-72:0.18880);
ATP  ((((((((IM08_NEUCR/20-86,IM08_SCHPO/21-85),((Q9Y0V8_CAEEL/12-78,IM8A_HUMAN/20-84),(IM8B_HUMAN/15-77,IM08_DROME/17-79))),IM08_ARATH/12-77),(((IM13A_RAT/23-87,((IM13_CAEEL/22-86,IM13_BRUMA/22-86),IM13_DROME/12-76)),(IM13_YEAST/34-95,IM13_SCHPO/22-86)),(IM13_ARATH/22-86,IM13_ORYSA/18-82))),(IM9A_CAEEL/1-66,(IM09_ORYSA/20-85,IM09_YEAST/12-77))),IM10_YEAST/17-83),Q9UTE9_SCHPO/16-82),Q9Y0V6_CAEEL/6-72,Q9Y0V5_CIOIN/6-72);
ATL  13.5084
DNO  20
DLN  201
DID  0.412516
DPH  (((((((IM08_SCHPO/21-85:0.58959,(IM8B_HUMAN/15-77:0.38496,IM08_DROME/17-79:0.17923):0.08905):0.06382,((Q9Y0V8_CAEEL/12-78:0.40373,IM08_NEUCR/20-86:0.42055):0.08409,IM8A_HUMAN/20-84:0.25495):0.10276):0.10987,((((IM13_YEAST/34-95:0.49658,IM13_SCHPO/22-86:0.13495):0.17198,(IM13A_RAT/23-87:0.20421,(IM13_CAEEL/22-86:0.50092,IM13_DROME/12-76:0.05810):0.11687):0.13847):0.12461,IM13_ARATH/22-86:0.42755):0.35346,IM08_ARATH/12-77:0.36099):0.12790):0.38584,((IM9A_CAEEL/1-66:0.50919,IM09_ORYSA/20-85:0.41122):0.15933,IM09_YEAST/12-77:0.28101):0.34586):0.45358,IM10_YEAST/17-83:0.12673):0.20407,Q9UTE9_SCHPO/16-82:0.42140):0.10194,Q9Y0V6_CAEEL/6-72:0.31219,Q9Y0V5_CIOIN/6-72:0.23468);
DTP  (((((((IM08_SCHPO/21-85,(IM8B_HUMAN/15-77,IM08_DROME/17-79)),((Q9Y0V8_CAEEL/12-78,IM08_NEUCR/20-86),IM8A_HUMAN/20-84)),((((IM13_YEAST/34-95,IM13_SCHPO/22-86),(IM13A_RAT/23-87,(IM13_CAEEL/22-86,IM13_DROME/12-76))),IM13_ARATH/22-86),IM08_ARATH/12-77)),((IM9A_CAEEL/1-66,IM09_ORYSA/20-85),IM09_YEAST/12-77)),IM10_YEAST/17-83),Q9UTE9_SCHPO/16-82),Q9Y0V6_CAEEL/6-72,Q9Y0V5_CIOIN/6-72);
DTL  9.8412
RID  0.285015
RPH  ((((((((IM08_NEUCR/20-86:0.83813,IM08_SCHPO/21-85:0.43578):0.19033,((Q9Y0V8_CAEEL/12-78:0.86994,IM8A_HUMAN/20-84:0.25388):0.28385,(IM8B_HUMAN/15-77:0.38600,IM08_DROME/17-79:0.20933):0.25190):0.07329):0.37386,IM08_ARATH/12-77:0.41401):0.23243,(((IM13_CAEEL/22-86:0.53416,(IM13A_RAT/23-87:0.27105,IM13_DROME/12-76:0.13130):0.10556):0.07973,(IM13_YEAST/34-95:0.61762,IM13_SCHPO/22-86:0.18788):0.14983):0.18103,IM13_ARATH/22-86:0.41854):0.29243):0.51902,(IM9A_CAEEL/1-66:0.73393,(IM09_ORYSA/20-85:0.35573,IM09_YEAST/12-77:0.38279):0.08903):0.72041):0.85310,IM10_YEAST/17-83:0.00289):0.37131,Q9UTE9_SCHPO/16-82:0.33555):0.29692,Q9Y0V6_CAEEL/6-72:0.28299,Q9Y0V5_CIOIN/6-72:0.18963);
RTP  ((((((((IM08_NEUCR/20-86,IM08_SCHPO/21-85),((Q9Y0V8_CAEEL/12-78,IM8A_HUMAN/20-84),(IM8B_HUMAN/15-77,IM08_DROME/17-79))),IM08_ARATH/12-77),(((IM13_CAEEL/22-86,(IM13A_RAT/23-87,IM13_DROME/12-76)),(IM13_YEAST/34-95,IM13_SCHPO/22-86)),IM13_ARATH/22-86)),(IM9A_CAEEL/1-66,(IM09_ORYSA/20-85,IM09_YEAST/12-77))),IM10_YEAST/17-83),Q9UTE9_SCHPO/16-82),Q9Y0V6_CAEEL/6-72,Q9Y0V5_CIOIN/6-72);
RTL  12.94
LNK  IM08_ARATH/12-77:Q9XGY4:AF150083
LNK  IM08_DROME/17-79:Q9Y1A3:AF142424
LNK  IM08_NEUCR/20-86:Q9Y8C0:AF142423
LNK  IM08_SCHPO/21-85:Q09783:AF143537
LNK  IM09_ORYSA/20-85:Q9XGX7:AF150113
LNK  IM09_YEAST/12-77:O74700:AF093244
LNK  IM10_YEAST/17-83:P87108:Z80875
LNK  IM13A_RAT/23-87:P62076:AF144701
LNK  IM13_ARATH/22-86:Q9XH48:AY136299
LNK  IM13_BRUMA/22-86:Q9Y193:
LNK  IM13_CAEEL/22-86:O45319:AF144704
LNK  IM13_DROME/12-76:Q9VTN3:AE003543
LNK  IM13_ORYSA/18-82:Q9XGY5:
LNK  IM13_SCHPO/22-86:Q10481:AF143538
LNK  IM13_YEAST/34-95:P53299:X99074
LNK  IM8A_HUMAN/20-84:O60220:U66035
LNK  IM8B_HUMAN/15-77:Q9Y5J9:AF152350
LNK  IM9A_CAEEL/1-66:Q17754:AF150108
LNK  Q9UTE9_SCHPO/16-82:Q9UTE9:AL132798
LNK  Q9Y0V5_CIOIN/6-72:Q9Y0V5:AF150095
LNK  Q9Y0V6_CAEEL/6-72:Q9Y0V6:AF150094
LNK  Q9Y0V8_CAEEL/12-78:Q9Y0V8:AF150086
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  IM09_YEAST/12-77
ASQ  FQKVVEQKQMKDFMRLYSNLVERCFTDCVNDFTT-SKLTNKEQTCIMKCSEKFLKHSERVGQRFQEQ
DSQ  TTCCAAAAAGTAGTGGAACAAAAGCAAATGAAGGATTTCATGCGTTTGTACTCTAATCTGGTAGAAAGATGTTTCACAGACTGTGTCAATGACTTCACAACA---TCAAAGCTAACCAATAAGGAACAAACATGCATCATGAAGTGCTCAGAAAAGTTCTTGAAGCATAGCGAACGTGTAGGGCAGCGTTTCCAAGAACAA
TRN  10010101100011001
NAM  IM09_ORYSA/20-85
ASQ  MAAMVDQLQIRDSLRMYNSLVERCFTDCVDTFRR-KTLDKQEESCVRRCAEKFLKHSMRVGMRFAEL
DSQ  ATGGCGGCCATGGTCGACCAGCTCCAGATCCGCGATAGTTTGAGAATGTACAACTCCCTCGTGGAACGATGCTTCACAGACTGCGTGGACACTTTCCGCCGG---AAGACCCTCGACAAGCAAGAGGAATCCTGCGTCCGCCGCTGCGCTGAGAAGTTCCTGAAGCACTCCATGAGGGTTGGCATGAGATTTGCTGAGCTT
TRN  10010101100011011
NAM  IM9A_CAEEL/1-66
ASQ  MTSEQNIQTFRDFLTQYNLVAEQCFNSCVNEFGS-RTVSGKEESCANNCLDKFLKMTQRVSQRFQEH
DSQ  ATGACCAGCGAACAGAACATCCAGACGTTCCGTGACTTCCTCACTCAATACAATTTGGTTGCTGAGCAGTGTTTCAACTCGTGTGTTAACGAGTTTGGAAGC---CGAACAGTCAGTGGAAAAGAAGAATCGTGCGCCAACAATTGTCTTGACAAGTTTCTCAAGATGACACAACGAGTTTCTCAACGATTCCAGGAGCAT
TRN  11011101111011011
NAM  Q9Y0V5_CIOIN/6-72
ASQ  AQKLAAELEVEMMADMYNRMTSSCHKKCISTRYDTGDLEKGEAVCIDRCVAKYLDIHEQIGKKLTEM
DSQ  GCACAGAAGTTGGCTGCCGAGCTCGAAGTAGAAATGATGGCAGATATGTACAACAGGATGACAAGCAGTTGTCATAAAAAGTGTATCAGCACAAGGTATGACACTGGGGATTTGGAAAAGGGGGAAGCTGTGTGTATAGATCGATGTGTAGCTAAATATTTGGACATTCATGAACAAATTGGGAAAAAGTTGACTGAAATG
TRN  10010101110011011
NAM  Q9Y0V6_CAEEL/6-72
ASQ  QMAQVAELEVEMMSDMYRRMTNSCQAKCIATAFRESELTKGEAVCLDRCVAKYLDVHEKLGKRLTSM
DSQ  CAAATGGCACAAGTTGCGGAGCTTGAGGTGGAAATGATGTCGGATATGTACCGCCGAATGACCAATTCGTGTCAGGCAAAGTGCATTGCCACCGCCTTCAGAGAGTCCGAATTGACAAAGGGAGAAGCCGTCTGCTTGGATCGTTGTGTTGCAAAGTATCTGGATGTTCACGAGAAGCTCGGAAAACGGTTGACAAGCATG
TRN  10010101100011011
NAM  Q9UTE9_SCHPO/16-82
ASQ  QNIAMAEQEVEMMSDIFNRLVMTCHKKCISPKYYEADLTKGESVCIDRCVSKYFEANQSLSQHMQKR
DSQ  CAGAACATTGCTATGGCTGAGCAAGAGGTTGAGATGATGTCTGATATCTTTAATAGACTTGTAATGACCTGTCATAAAAAGTGCATATCTCCTAAATACTATGAAGCCGATTTAACGAAAGGAGAAAGCGTGTGTATTGACCGTTGTGTATCGAAATACTTTGAAGCAAATCAGAGTCTTTCACAGCACATGCAAAAGCGT
TRN  10010101110011000
NAM  IM10_YEAST/17-83
ASQ  QKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESSCLDRCVAKYFETNVQVGENMQKM
DSQ  CAAAAGATTCAAGCTGCGGAAGCTGAACTAGATTTGGTCACAGACATGTTCAATAAATTGGTTAATAACTGTTATAAAAAATGTATCAATACTTCTTATTCCGAGGGTGAGCTGAATAAGAATGAATCTTCGTGCCTAGACAGATGTGTGGCCAAATATTTTGAGACCAATGTTCAAGTCGGTGAAAACATGCAGAAAATG
TRN  10010101100011011
NAM  IM08_DROME/17-79
ASQ  FLLIEKQKAQVNAQ--IHEFNEICWEKCIGKPS--TKLDHATETCLSNCVDRFIDTSLLITQRFAQM
DSQ  TTCCTCTTGATTGAGAAACAGAAGGCACAGGTCAACGCGCAG------ATACACGAGTTCAACGAGATCTGCTGGGAGAAGTGCATCGGCAAGCCGAGT------ACCAAGCTGGACCACGCCACCGAGACGTGCCTGAGCAACTGCGTCGACCGATTCATCGACACGTCGCTGCTTATCACCCAGCGGTTCGCTCAGATG
TRN  10010101100011011
NAM  IM8B_HUMAN/15-77
ASQ  LVAAEQQKAQFTAQ--VHHFMELCWDKCVEKPG--NRLDSRTENCLSSCVDRFIDTTLAITSRFAQI
DSQ  CTGGTGGCCGCCGAGCAGCAGAAGGCGCAGTTTACTGCACAG------GTGCATCACTTCATGGAGTTATGTTGGGATAAATGTGTGGAGAAGCCAGGG------AATCGCCTAGACTCTCGCACTGAAAATTGTCTCTCCAGCTGTGTAGACCGCTTCATTGACACCACTCTTGCCATCACCAGTCGGTTTGCCCAGATT
TRN  11011101101011010
NAM  IM8A_HUMAN/20-84
ASQ  QHFIEVETQKQRFQQLVHQMTELCWEKCMDKPG--PKLDSRAEACFVNCVERFIDTSQFILNRLEQT
DSQ  CAGCATTTCATCGAGGTAGAGACTCAAAAGCAGCGCTTCCAGCAGCTGGTGCACCAGATGACTGAACTTTGTTGGGAGAAGTGCATGGACAAGCCTGGG------CCAAAGTTGGACAGTCGGGCTGAGGCCTGTTTTGTGAACTGCGTTGAGCGCTTCATTGATACAAGCCAGTTCATCTTGAATCGACTGGAACAGACC
TRN  11011111101111111
NAM  IM08_SCHPO/21-85
ASQ  SKFIESEQQKVKLQQAIHQFTSTCWPKCIGNIG--NKLDKSEEQCLQNCVERFLDCNFHIIKRYALE
DSQ  TCAAAATTTATTGAAAGTGAGCAGCAGAAGGTTAAGCTACAGCAAGCAATTCACCAATTTACCTCTACTTGCTGGCCAAAGTGTATTGGAAATATTGGC------AATAAGCTAGATAAATCTGAAGAACAATGCTTACAAAATTGTGTCGAACGTTTTCTTGATTGTAACTTCCACATCATCAAAAGGTATGCTCTTGAA
TRN  10010101110011000
NAM  IM08_NEUCR/20-86
ASQ  RGFISNETQRQRVQGQTHALTDSCWKKCVTSPIKTNQLDKTEAVCMADCVERFLDVNLTIMAHVQKI
DSQ  CGCGGTTTCATTTCCAACGAGACGCAGCGCCAGAGGGTGCAAGGACAGACCCACGCCCTTACCGATTCCTGCTGGAAGAAATGCGTCACCTCCCCCATCAAGACCAACCAGCTCGACAAGACCGAGGCCGTCTGCATGGCGGACTGCGTTGAGCGCTTCCTGGACGTCAACCTGACCATCATGGCCCACGTGCAAAAGATC
TRN  10010101100011011
NAM  Q9Y0V8_CAEEL/12-78
ASQ  LQQLQAETQRQKFTEQVHTLTGRCWDVCFADYRPPSKMDGKTQTCFQNCVNRMIDASNFMVEHLSKM
DSQ  CTCCAGCAACTGCAGGCGGAGACGCAGCGTCAAAAATTCACCGAACAAGTGCACACGCTCACCGGTCGCTGCTGGGATGTGTGCTTCGCCGACTACCGTCCGCCAAGCAAGATGGACGGCAAGACTCAGACCTGTTTTCAGAACTGCGTAAACCGCATGATCGACGCCAGCAACTTCATGGTCGAGCACTTGTCCAAGATG
TRN  11011101101011011
NAM  IM08_ARATH/12-77
ASQ  LQFLAQEKERAMVNEMVSKMTSVCWDKCITSAPG-SKFSSSESSCLTHCAQRYMDMSMIIMKRFNSQ
DSQ  CTTCAATTCCTCGCCCAAGAGAAAGAAAGAGCAATGGTGAACGAAATGGTGTCGAAGATGACAAGTGTGTGCTGGGACAAATGCATCACAAGCGCACCGGGA---AGTAAGTTCAGCTCAAGCGAGAGTTCTTGCCTCACTCATTGCGCTCAACGCTACATGGATATGAGTATGATCATCATGAAACGCTTTAATTCGCAG
TRN  10010101110011001
NAM  IM13_ORYSA/18-82
ASQ  MDQIKAQLAQAYAQEFLETVGNKCFAXCVTKPG--SSLSGSESSCISRCVDRYIEATGIVSRXLFXS
NAM  IM13_ARATH/22-86
ASQ  MESVKTQLAQAYAEELIETLRTKCFDKCVTKPG--SSLGGSESSCISRCVERYMEATAIISRSLFTQ
DSQ  ATGGAGTCGGTCAAGACTCAGCTCGCTCAAGCTTACGCCGAAGAGTTAATCGAGACTTTGAGGACAAAATGTTTTGACAAGTGCGTAACGAAGCCAGGA------TCAAGCCTCGGTGGAAGTGAGAGTAGCTGTATTTCGAGATGTGTTGAACGTTACATGGAAGCTACTGCAATCATAAGTCGTTCTCTTTTCACTCAA
TRN  10010101110011000
NAM  IM13_DROME/12-76
ASQ  MNQVKQQIALANAQEMLSKMTEKCFKKCIQKPG--KSLDSTEQRCISQCMDRFMDAWNLVSRTYGNR
DSQ  ATGAACCAGGTGAAACAACAGATCGCATTGGCCAATGCCCAGGAGATGCTCTCGAAGATGACGGAGAAGTGCTTCAAGAAGTGCATCCAGAAGCCGGGA------AAATCACTGGACTCCACCGAGCAGCGTTGCATTTCGCAGTGCATGGATCGCTTCATGGACGCCTGGAATCTGGTGTCGCGCACCTATGGCAATCGT
TRN  11011101101011001
NAM  IM13A_RAT/23-87
ASQ  MEQVKVQIAVANAQELLQRMTDKCFRKCIGKPG--GSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSR
DSQ  ATGGAACAGGTGAAAGTGCAGATCGCCGTGGCCAATGCGCAGGAGCTGCTACAGAGGATGACGGACAAGTGTTTCCGGAAGTGCATCGGGAAGCCCGGG------GGCTCCTTAGATAACTCGGAGCAGAAATGCATCGCCATGTGCATGGACCGGTACATGGACGCCTGGAACACCGTGTCCCGCGCCTACAACTCCCGA
TRN  10010101100011010
NAM  IM13_SCHPO/22-86
ASQ  MKQIRQELAVAQAGELISKINENCFDKCIPEPG--STFDPNEKSCVSKCMERYMDAWNIVSRTYISR
DSQ  ATGAAACAAATTCGTCAGGAACTTGCTGTTGCTCAAGCTGGCGAATTGATAAGTAAAATCAATGAGAACTGTTTTGATAAATGTATCCCGGAGCCTGGT------TCCACATTCGATCCCAATGAAAAGTCTTGCGTTTCCAAATGTATGGAACGCTATATGGATGCTTGGAACATTGTTTCTCGAACCTATATCTCTCGT
TRN  10010101110011011
NAM  IM13_BRUMA/22-86
ASQ  ISGVKQQAAILTAQNMITDXSERCLTKCITXPG--SALSXTERQCLQRCMDRFMETYXLASQXLQNR
NAM  IM13_CAEEL/22-86
ASQ  ISGVKQQAALANAQNLVTDISEKCTNKCITAPG--SSLASGEKQCLQRCMDRFMESWNLVSQTLQKR
DSQ  ATCAGTGGTGTCAAGCAGCAAGCTGCCCTTGCCAATGCCCAGAATCTTGTCACGGACATTTCTGAAAAGTGCACGAATAAATGCATCACTGCACCAGGA------AGCTCATTGGCCAGTGGTGAAAAGCAATGTCTACAGCGATGCATGGATCGTTTCATGGAATCATGGAATCTTGTTTCTCAAACTCTTCAAAAACGT
TRN  11011101111011001
NAM  IM13_YEAST/34-95
ASQ  KNQIAQELAVANATELVNKISENCFEKCLTSPY---AT--RNDACIDQCLAKYMRSWNVISKAYISR
DSQ  AAAAACCAAATTGCTCAAGAACTGGCTGTGGCTAATGCGACTGAATTAGTGAACAAAATTTCTGAGAACTGCTTTGAAAAATGCTTAACTTCGCCATAC---------GCTACC------AGAAACGATGCGTGCATTGACCAGTGTTTGGCTAAATATATGAGAAGTTGGAATGTCATATCAAAGGCTTACATCTCCAGA
TRN  10010101100011000
//