EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02947 - Flt3_lig)
FAM  PF02947
PID  Flt3_lig
DES  flt3 ligand
IPR  IPR004213
ANO  3
ALN  135
AID  0.828125
APH  (Q61104_MOUSE/28-162:0.00000,FLT3L_MOUSE/28-162:0.00000,FLT3L_HUMAN/27-159:0.31724);
ATP  (Q61104_MOUSE/28-162,FLT3L_MOUSE/28-162,FLT3L_HUMAN/27-159);
ATL  0.31724
DNO  3
DLN  405
DID  0.847953
DPH  (Q61104_MOUSE/28-162:0.00000,FLT3L_MOUSE/28-162:0.00000,FLT3L_HUMAN/27-159:0.27314);
DTP  (Q61104_MOUSE/28-162,FLT3L_MOUSE/28-162,FLT3L_HUMAN/27-159);
DTL  0.27314
RID  0.828125
RPH  (Q61104_MOUSE/28-162:0.00000,FLT3L_MOUSE/28-162:0.00000,FLT3L_HUMAN/27-159:0.31724);
RTP  (Q61104_MOUSE/28-162,FLT3L_MOUSE/28-162,FLT3L_HUMAN/27-159);
RTL  0.31724
LNK  FLT3L_HUMAN/27-159:P49771:U03858
LNK  FLT3L_MOUSE/28-162:P49772:L23636
LNK  Q61104_MOUSE/28-162:Q61104:U44024
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q61104_MOUSE/28-162
ASQ  TPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQ
DSQ  ACACCTGACTGTTACTTCAGCCACAGTCCCATCTCCTCCAACTTCAAAGTGAAGTTTAGAGAGTTGACTGACCACCTGCTTAAAGATTACCCAGTCACTGTGGCCGTCAATCTTCAGGACGAGAAGCACTGCAAGGCCTTGTGGAGCCTCTTCCTAGCCCAGCGCTGGATAGAGCAACTGAAGACTGTGGCAGGGTCTAAGATGCAAACGCTTCTGGAGGACGTCAACACCGAGATACATTTTGTCACCTCATGTACCTTCCAGCCCCTACCAGAATGTCTGCGATTCGTCCAGACCAACATCTCCCACCTCCTGAAGGACACCTGCACACAGCTGCTTGCTCTGAAGCCCTGTATCGGGAAGGCCTGCCAGAATTTCTCTCGGTGCCTGGAGGTGCAGTGCCAG
TRN  10010101100011001
NAM  FLT3L_MOUSE/28-162
ASQ  TPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQ
DSQ  ACACCTGACTGTTACTTCAGCCACAGTCCCATCTCCTCCAACTTCAAAGTGAAGTTTAGAGAGTTGACTGACCACCTGCTTAAAGATTACCCAGTCACTGTGGCCGTCAATCTTCAGGACGAGAAGCACTGCAAGGCCTTGTGGAGCCTCTTCCTAGCCCAGCGCTGGATAGAGCAACTGAAGACTGTGGCAGGGTCTAAGATGCAAACGCTTCTGGAGGACGTCAACACCGAGATACATTTTGTCACCTCATGTACCTTCCAGCCCCTACCAGAATGTCTGCGATTCGTCCAGACCAACATCTCCCACCTCCTGAAGGACACCTGCACACAGCTGCTTGCTCTGAAGCCCTGTATCGGGAAGGCCTGCCAGAATTTCTCTCGGTGCCTGGAGGTGCAGTGCCAG
TRN  10010101100011001
NAM  FLT3L_HUMAN/27-159
ASQ  TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITR--QNFSRCLELQCQ
DSQ  ACCCAGGACTGCTCCTTCCAACACAGCCCCATCTCCTCCGACTTCGCTGTCAAAATCCGTGAGCTGTCTGACTACCTGCTTCAAGATTACCCAGTCACCGTGGCCTCCAACCTGCAGGACGAGGAGCTCTGCGGGGGCCTCTGGCGGCTGGTCCTGGCACAGCGCTGGATGGAGCGGCTCAAGACTGTCGCTGGGTCCAAGATGCAAGGCTTGCTGGAGCGCGTGAACACGGAGATACACTTTGTCACCAAATGTGCCTTTCAGCCCCCCCCCAGCTGTCTTCGCTTCGTCCAGACCAACATCTCCCGCCTCCTGCAGGAGACCTCCGAGCAGCTGGTGGCGCTGAAGCCCTGGATCACTCGC------CAGAACTTCTCCCGGTGCCTGGAGCTGCAGTGTCAG
TRN  10010101100011011
//