EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02943 - FeThRed_B)
FAM  PF02943
PID  FeThRed_B
DES  Ferredoxin thioredoxin reductase catalytic beta chain
IPR  IPR004209
ANO  4
ALN  105
AID  0.663939
APH  ((Q55389_SYNY3/10-114:0.18117,FTRC_MAIZE/45-149:0.26842):0.11481,FTRC_PORPU/11-115:0.13891,FTRC_CYACA/6-110:0.30929);
ATP  ((Q55389_SYNY3/10-114,FTRC_MAIZE/45-149),FTRC_PORPU/11-115,FTRC_CYACA/6-110);
ATL  1.0126
DNO  3
DLN  315
DID  0.647619
DPH  (FTRC_CYACA/6-110:0.22886,FTRC_PORPU/11-115:0.22244,Q55389_SYNY3/10-114:0.30128);
DTP  (FTRC_CYACA/6-110,FTRC_PORPU/11-115,Q55389_SYNY3/10-114);
DTL  0.75258
RID  0.681212
RPH  (FTRC_CYACA/6-110:0.30313,FTRC_PORPU/11-115:0.14992,Q55389_SYNY3/10-114:0.25402);
RTP  (FTRC_CYACA/6-110,FTRC_PORPU/11-115,Q55389_SYNY3/10-114);
RTL  0.70707
LNK  FTRC_CYACA/6-110:Q9TM25:AF022186
LNK  FTRC_MAIZE/45-149:P41347:
LNK  FTRC_PORPU/11-115:P51386:U38804
LNK  Q55389_SYNY3/10-114:Q55389:BA000022
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  FTRC_CYACA/6-110
ASQ  KNLESLHKFAEAYAKLSRTYFCIDQSITALVIEGLARHKDDYGAPLCPCRHYENKKTEVLAAYWNCPCVPMRERKECHCMLFLQPSNEFSGESQLISKDDLQKHL
DSQ  AAAAACTTAGAATCTTTACATAAATTTGCTGAGGCATATGCTAAATTAAGTCGTACTTACTTTTGCATTGACCAGTCAATTACTGCGCTTGTGATCGAAGGGTTGGCTAGACATAAAGATGATTATGGCGCGCCTCTATGCCCTTGTAGGCATTATGAAAACAAAAAAACAGAAGTATTGGCTGCTTATTGGAATTGTCCTTGCGTCCCCATGAGGGAGAGAAAAGAATGTCATTGTATGTTGTTTTTACAACCGAGCAATGAGTTTTCTGGAGAGAGCCAATTAATAAGTAAAGATGATTTACAGAAACATTTA
TRN  10010101110011000
NAM  FTRC_PORPU/11-115
ASQ  DNLEAMRKFSETYAKRTGTFFCADNSVTAVVIEGLARHKDKYGAPLCPCRHYEDKKAEISATYWNCPCVPMRERKECHCMLFLTPDNEFTSDLQEIDKTTLLEKI
DSQ  GACAATCTCGAAGCTATGAGAAAGTTCTCTGAGACTTATGCAAAACGCACAGGAACTTTTTTTTGTGCAGATAACAGCGTAACAGCAGTTGTAATAGAAGGGTTAGCTAGGCACAAAGATAAGTATGGCGCCCCACTTTGTCCATGTAGACATTATGAAGATAAAAAAGCTGAAATTTCAGCTACATACTGGAACTGTCCTTGTGTGCCAATGAGAGAAAGAAAAGAATGTCATTGCATGCTCTTTCTAACACCAGACAATGAATTTACTAGTGATTTACAAGAAATAGATAAAACAACTTTACTAGAAAAAATA
TRN  10010101110011000
NAM  Q55389_SYNY3/10-114
ASQ  KTLAAMKNFAEQYAKRTDTYFCSDLSVTAVVIEGLARHKEELGSPLCPCRHYEDKEAEVKNTFWNCPCVPMRERKECHCMLFLTPDNDFAGDAQDIPMETLEEVK
DSQ  AAAACACTGGCCGCAATGAAAAATTTTGCGGAGCAGTATGCTAAACGTACGGATACCTATTTTTGTAGTGATCTTTCCGTCACCGCCGTTGTTATCGAGGGTTTAGCTCGCCATAAAGAGGAATTGGGTTCTCCCCTGTGCCCCTGTCGCCACTACGAAGACAAGGAAGCGGAAGTAAAAAATACCTTTTGGAATTGCCCCTGTGTGCCTATGCGGGAGCGCAAGGAATGTCACTGTATGTTGTTTTTAACCCCAGATAACGATTTTGCTGGGGATGCCCAGGATATTCCCATGGAAACTTTGGAGGAAGTCAAG
TRN  11011101101011010
NAM  FTRC_MAIZE/45-149
ASQ  KSVEVMRKFSEQYARRSNTFFCADKTVTAVVIKGLADHRDTLGAPLCPCRHYDDKAAEVAQGFWNCPCVPMRERKECHCMLFLTPDNDFAGKDQVISFEEIKEAT
//