EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02937 - COX6C)
FAM  PF02937
PID  COX6C
DES  Cytochrome c oxidase subunit VIc
IPR  IPR004204
ANO  4
ALN  75
AID  0.524539
APH  (CX6C1_RAT/1-75:0.37102,(COX6C_HUMAN/1-75:0.06474,Q9VMS1_DROME/4-77:1.03451):0.14859,COX6C_BOVIN/1-73:0.12178);
ATP  (CX6C1_RAT/1-75,(COX6C_HUMAN/1-75,Q9VMS1_DROME/4-77),COX6C_BOVIN/1-73);
ATL  1.74064
DNO  3
DLN  225
DID  0.550482
DPH  (Q9VMS1_DROME/4-77:0.90731,CX6C1_RAT/1-75:0.24591,COX6C_HUMAN/1-75:0.03960);
DTP  (Q9VMS1_DROME/4-77,CX6C1_RAT/1-75,COX6C_HUMAN/1-75);
DTL  1.19282
RID  0.45759
RPH  (Q9VMS1_DROME/4-77:1.05012,CX6C1_RAT/1-75:0.48672,COX6C_HUMAN/1-75:0.03724);
RTP  (Q9VMS1_DROME/4-77,CX6C1_RAT/1-75,COX6C_HUMAN/1-75);
RTL  1.57408
LNK  COX6C_BOVIN/1-73:P04038:
LNK  COX6C_HUMAN/1-75:P09669:X13238
LNK  CX6C1_RAT/1-75:P11950:M20183
LNK  Q9VMS1_DROME/4-77:Q9VMS1:AE003609
AMK  ..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  ......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9VMS1_DROME/4-77
ASQ  tpATSSAGPVLRGLHNATIKRNLAVSLGLTAVVTIAYKILVNDPKKAAYADFYSKYDANKSFERMKAAGRFQSC-
DSQ  actccaGCCACCTCCTCTGCCGGACCCGTGCTCCGTGGCCTCCACAATGCCACCATCAAGCGCAACCTGGCCGTTTCCCTGGGCCTGACCGCCGTGGTGACCATCGCCTACAAAATTCTGGTCAACGATCCCAAGAAGGCCGCCTACGCCGACTTCTACTCGAAGTACGATGCCAACAAGTCCTTCGAGCGCATGAAGGCCGCCGGTCGTTTCCAGTCCTGC---
TRN  11011101101011011
NAM  CX6C1_RAT/1-75
ASQ  ssGALLPKPQMHDPLSKRLWVHIVGAFIVDLGVAAAHKFGAAKPRKKAYADFYRNHDPMKDFDEMRKAGVFRSVK
DSQ  agttccGGTGCACTGTTGCCGAAACCTCAGATGCATGATCCTCTGTCCAAGCGTCTGTGGGTTCATATTGTTGGTGCATTCATTGTGGACCTGGGAGTTGCTGCTGCCCATAAGTTTGGTGCAGCTAAACCAAGAAAGAAGGCATATGCAGATTTCTACAGGAATCATGATCCCATGAAAGATTTTGACGAGATGAGGAAGGCTGGAGTCTTTCGGAGTGTGAAG
TRN  10010101100011011
NAM  COX6C_HUMAN/1-75
ASQ  maPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
DSQ  atggctCCCGAAGTTTTGCCAAAACCTCGGATGCGTGGCCTTCTGGCCAGGCGTCTGCGAAATCATATGGCTGTAGCATTCGTGCTATCCCTGGGGGTTGCAGCTTTGTATAAGTTTCGTGTGGCTGATCAAAGAAAGAAGGCATACGCAGATTTCTACAGAAACTACGATGTCATGAAAGATTTTGAGGAGATGAGGAAGGCTGGTATCTTTCAGAGTGTAAAG
TRN  10010101100011011
NAM  COX6C_BOVIN/1-73
ASQ  ..STALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK
//