EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02923 - BamHI)
FAM  PF02923
PID  BamHI
DES  Restriction endonuclease BamHI
IPR  IPR004194
ANO  2
ALN  169
AID  0.375887
APH  (Q9RM91_BACSP/1-158:0.90127,T2BA_BACAM/1-168:0.41376);
ATP  (Q9RM91_BACSP/1-158,T2BA_BACAM/1-168);
ATL  1.31503
DNO  2
DLN  507
DID  0.501062
DPH  (Q9RM91_BACSP/1-158:0.29540,T2BA_BACAM/1-168:0.55567);
DTP  (Q9RM91_BACSP/1-158,T2BA_BACAM/1-168);
DTL  0.85108
RID  0.375887
RPH  (Q9RM91_BACSP/1-158:0.98098,T2BA_BACAM/1-168:0.33405);
RTP  (Q9RM91_BACSP/1-158,T2BA_BACAM/1-168);
RTL  1.31503
LNK  Q9RM91_BACSP/1-158:Q9RM91:AJ245583
LNK  T2BA_BACAM/1-168:P23940:X55285
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9RM91_BACSP/1-158
ASQ  MKVKNVEVLIDKGRN----TQEIESIKAHVLNSIENMQYPANSGAFHLYGGKKAN-GVKPIKDS-YMMHQQEHGWILEYKLDVG-VTNSRPGPIDAVLPVS--D--KYFAVEWETGNIASSHRAINKMIVGMLNGKLIGGILILPSREMYDYLTDRVGNFRELSPYFDV
DSQ  ATGAAAGTAAAAAATGTTGAAGTTTTAATCGATAAAGGTCGTAAT------------ACACAGGAAATTGAAAGCATAAAGGCACATGTCTTAAATTCAATTGAAAACATGCAATACCCAGCAAACTCAGGTGCGTTTCACCTATATGGTGGTAAGAAAGCAAAT---GGTGTGAAACCAATAAAGGATTCT---TACATGATGCATCAGCAAGAGCATGGATGGATTTTAGAATACAAACTAGATGTAGGT---GTTACTAATTCTCGTCCGGGTCCTATTGATGCAGTATTACCTGTAAGT------GAT------AAGTATTTTGCAGTTGAGTGGGAAACTGGAAACATTGCATCGTCACATCGAGCAATCAATAAGATGATTGTAGGAATGCTGAATGGAAAATTAATAGGTGGTATCTTGATTTTACCTTCACGTGAAATGTACGATTATTTAACAGATCGTGTAGGGAACTTCAGAGAGCTAAGCCCTTATTTTGATGTT
TRN  10010101100011000
NAM  T2BA_BACAM/1-168
ASQ  MEVEK-EFITDEAKELLSKDKLIQQAYNEVKTSICSPIWPATSKTFTINNTEKNCNGVVPIKELCYTLLEDTYNWYREKPLDILKLEKKKGGPIDVYKEFIENSELKRVGMEFETGNISSAHRSMNKLLLGLKHGEIDLAIILMPIKQLAYYLTDRVTNFEELEPYFEL
DSQ  ATGGAAGTAGAAAAA---GAGTTTATTACTGATGAAGCAAAAGAATTACTATCTAAAGATAAGTTAATTCAACAAGCATACAATGAAGTTAAAACATCTATTTGTTCACCTATTTGGCCAGCAACCTCAAAAACCTTCACGATTAACAACACCGAAAAGAATTGTAACGGTGTAGTACCAATTAAAGAACTATGTTACACCTTACTTGAAGATACATATAACTGGTATAGAGAAAAACCCCTTGATATACTTAAACTTGAAAAGAAAAAAGGTGGTCCGATTGATGTTTATAAAGAGTTCATAGAAAACAGTGAACTTAAACGTGTAGGTATGGAATTTGAAACAGGAAATATTAGTTCTGCCCACCGTTCAATGAACAAACTTCTATTAGGATTAAAACATGGCGAAATTGATTTGGCTATTATCCTTATGCCTATTAAACAATTGGCCTATTATCTTACAGATCGTGTTACCAATTTCGAGGAATTAGAACCTTATTTTGAACTT
TRN  10010101110011000
//