EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02918 - Pertussis_S2S3)
FAM  PF02918
PID  Pertussis_S2S3
DES  Pertussis toxin, subunit 2 and 3, C-terminal domain
IPR  IPR003899
ANO  2
ALN  109
AID  0.761905
APH  (TOX3_BORPE/118-226:0.12911,TOX2_BORPE/117-225:0.15548);
ATP  (TOX3_BORPE/118-226,TOX2_BORPE/117-225);
ATL  0.28459
DNO  2
DLN  327
DID  0.807339
DPH  (TOX3_BORPE/118-226:0.22518,TOX2_BORPE/117-225:0.00000);
DTP  (TOX3_BORPE/118-226,TOX2_BORPE/117-225);
DTL  0.22518
RID  0.761905
RPH  (TOX3_BORPE/118-226:0.18024,TOX2_BORPE/117-225:0.10436);
RTP  (TOX3_BORPE/118-226,TOX2_BORPE/117-225);
RTL  0.28459
LNK  TOX2_BORPE/117-225:P04978:M14378
LNK  TOX3_BORPE/118-226:P04979:M14378
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  TOX3_BORPE/118-226
ASQ  TIYKTGQPAADHYYSKVTATRLLASTNSRLCAVFVRDGQSVIGACASPYEGRYRDMYDALRRLLYMIYMSGLAVRVHVSKEEQYYDYEDATFQTYALTGISLCNPAASI
DSQ  ACCATATACAAGACCGGGCAACCGGCTGCGGATCACTACTACAGCAAGGTCACGGCCACGCGCCTGCTCGCCAGCACCAACAGCAGGCTGTGCGCGGTATTCGTCAGGGACGGGCAATCGGTCATCGGAGCCTGCGCCAGCCCGTATGAAGGCAGGTACAGAGACATGTACGACGCGCTGCGGCGCCTGCTGTACATGATCTATATGTCCGGCCTTGCCGTACGCGTCCACGTCAGCAAGGAAGAGCAGTATTACGACTACGAGGACGCCACATTCCAGACCTATGCCCTCACCGGCATTTCCCTCTGCAACCCGGCAGCGTCGATA
TRN  10010101100011011
NAM  TOX2_BORPE/117-225
ASQ  TTRNTGQPATDHYYSNVTATRLLSSTNSRLCAVFVRSGQPVIGACTSPYDGKYWSMYSRLRKMLYLIYVAGISVRVHVSKEEQYYDYEDATFETYALTGISICNPGSSL
DSQ  ACCACGCGCAATACGGGTCAACCCGCAACGGATCACTACTACAGCAACGTCACCGCCACTCGCCTGCTCTCCAGCACCAACAGCAGGCTATGCGCGGTCTTCGTCAGAAGCGGGCAACCGGTCATTGGCGCCTGCACCAGCCCGTATGACGGCAAGTACTGGAGCATGTACAGCCGGCTGCGGAAAATGCTTTACCTGATCTACGTGGCCGGCATCTCCGTACGCGTCCATGTCAGCAAGGAAGAACAGTATTACGACTATGAGGACGCAACGTTCGAGACTTACGCCCTTACCGGCATCTCCATCTGCAATCCTGGATCATCCTTA
TRN  10010101100011000
//