EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02884 - Lyase_8_C)
FAM  PF02884
PID  Lyase_8_C
DES  Polysaccharide lyase family 8, C-terminal beta-sandwich domain
IPR  IPR004103
ANO  5
ALN  84
AID  0.186448
APH  (HYSA_STRPN/932-1004:0.34535,(HYSA_STRA3/913-984:0.35882,(CSLA_PEDHE/600-672:1.28660,O86516_STRCO/665-748:3.08848):0.84082):0.47071,HYSA_STAAU/705-780:1.00547);
ATP  (HYSA_STRPN/932-1004,(HYSA_STRA3/913-984,(CSLA_PEDHE/600-672,O86516_STRCO/665-748)),HYSA_STAAU/705-780);
ATL  7.39625
DNO  5
DLN  252
DID  0.371286
DPH  (HYSA_STRPN/932-1004:0.26017,(HYSA_STRA3/913-984:0.45536,(CSLA_PEDHE/600-672:0.73668,O86516_STRCO/665-748:1.07096):0.59207):0.07978,HYSA_STAAU/705-780:0.52142);
DTP  (HYSA_STRPN/932-1004,(HYSA_STRA3/913-984,(CSLA_PEDHE/600-672,O86516_STRCO/665-748)),HYSA_STAAU/705-780);
DTL  3.71644
RID  0.186448
RPH  (HYSA_STRPN/932-1004:0.34535,(HYSA_STRA3/913-984:0.35882,(CSLA_PEDHE/600-672:1.28660,O86516_STRCO/665-748:3.08848):0.84082):0.47071,HYSA_STAAU/705-780:1.00547);
RTP  (HYSA_STRPN/932-1004,(HYSA_STRA3/913-984,(CSLA_PEDHE/600-672,O86516_STRCO/665-748)),HYSA_STAAU/705-780);
RTL  7.39625
LNK  CSLA_PEDHE/600-672:Q59288:U27583
LNK  HYSA_STAAU/705-780:Q59801:U21221
LNK  HYSA_STRA3/913-984:Q53591:U15050
LNK  HYSA_STRPN/932-1004:Q54873:AE007344
LNK  O86516_STRCO/665-748:O86516:AL939124
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O86516_STRCO/665-748
ASQ  LTVLANDDRRQAVSVPSLGLTAANFWQAGTAGPLTTTAGASVLVRRRGRTATLRVSEPPRTGEALEIVWDHPVGAVLRADETVE
DSQ  CTCACGGTCCTCGCCAACGACGACCGCCGCCAGGCGGTGAGCGTCCCCTCCCTCGGTCTGACGGCCGCCAACTTCTGGCAGGCCGGCACCGCGGGCCCGCTCACCACCACGGCCGGGGCGAGTGTGCTCGTCCGCCGCCGCGGCCGTACCGCTACGCTCCGGGTGAGCGAACCGCCGCGCACGGGAGAGGCCCTGGAGATCGTCTGGGACCACCCGGTGGGCGCGGTGCTGCGGGCCGACGAGACGGTCGAG
TRN  11011111101111111
NAM  CSLA_PEDHE/600-672
ASQ  PKVLANTNQLQAVYHQ-----QLDMVQAIFYTAGKLS----VAGIEIETDKPCAVLIKHINGK--QVIWAADPLQKEKTAVLSI
DSQ  CCGAAAGTCCTTGCCAATACCAACCAGCTGCAGGCAGTTTATCATCAG---------------CAGTTAGATATGGTACAGGCTATCTTCTATACAGCTGGAAAATTAAGC------------GTAGCGGGCATAGAAATTGAAACAGATAAGCCATGTGCAGTGCTGATCAAGCACATCAATGGCAAG------CAGGTAATTTGGGCTGCCGATCCATTGCAAAAAGAAAAGACTGCAGTGTTGAGCATC
TRN  10010101100011010
NAM  HYSA_STRPN/932-1004
ASQ  SSLIENNETLQSVYDA-----KQGVWGIVKYDDSVST----ISN-QFQVLKRGVYTIRKEGDE-YKIAYYNPETQESAPDQEVF
DSQ  AGTAGCCTCATCGAAAATAACGAAACCCTTCAGTCTGTTTATGATGCT---------------AAACAAGGAGTTTGGGGCATTGTGAAATATGATGATTCTGTCTCTACT------------ATTTCCAAC---CAATTCCAAGTTTTGAAACGTGGAGTCTATACCATTCGAAAAGAAGGGGATGAA---TATAAGATTGCCTACTATAATCCTGAAACCCAGGAATCAGCTCCAGATCAGGAAGTCTTT
TRN  11011101111011001
NAM  HYSA_STRA3/913-984
ASQ  VELLENSSKQQVIYDK-----NSQTWAVIKHDNQESL----INN-QFKMNKAGLYLVQKVGND-YQNVYYQPQTMTKT-DQLAI
DSQ  GTAGAATTACTAGAAAATAGTTCAAAACAACAAGTTATCTATGATAAA---------------AACAGTCAAACTTGGGCTGTTATCAAACACGATAATCAAGAGAGTCTC------------ATTAACAAT---CAATTCAAAATGAATAAAGCGGGACTTTACCTAGTACAAAAAGTTGGTAATGAC---TATCAAAATGTCTATTACCAACCTCAAACCATGACAAAAACA---GACCAATTAGCTATC
TRN  11011101111011000
NAM  HYSA_STAAU/705-780
ASQ  VTVVKQEDDFHVVKD------NESVWAGVNYSNSTQTF--DINNTKVEVKAKGMFILKKKDDNTYECSFYNPESTNSASDIESK
DSQ  GTAACTGTCGTTAAGCAAGAAGATGACTTCCACGTTGTGAAAGAT------------------AATGAATCGGTTTGGGCTGGTGTTAATTATAGTAATAGCACTCAAACTTTT------GACATTAACAACACTAAAGTCGAAGTTAAAGCCAAAGGTATGTTTATACTTAAAAAGAAAGATGATAACACTTATGAATGTAGCTTCTATAATCCTGAATCTACAAATTCCGCTTCAGATATTGAATCTAAA
TRN  10010101110011001
//