EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02831 - gpW)
FAM  PF02831
PID  gpW
DES  gpW
IPR  IPR004174
ANO  2
ALN  68
AID  0.5
APH  (VG03_ECOL6/1-68:0.53011,VHTJ_LAMBD/1-68:0.30283);
ATP  (VG03_ECOL6/1-68,VHTJ_LAMBD/1-68);
ATL  0.83294
DNO  2
DLN  204
DID  0.534314
DPH  (VG03_ECOL6/1-68:0.23581,VHTJ_LAMBD/1-68:0.50064);
DTP  (VG03_ECOL6/1-68,VHTJ_LAMBD/1-68);
DTL  0.73645
RID  0.5
RPH  (VG03_ECOL6/1-68:0.53011,VHTJ_LAMBD/1-68:0.30283);
RTP  (VG03_ECOL6/1-68,VHTJ_LAMBD/1-68);
RTL  0.83294
LNK  VG03_ECOL6/1-68:P68655:AE016759
LNK  VHTJ_LAMBD/1-68:P68660:J02459
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VG03_ECOL6/1-68
ASQ  MVTVAELQALRQARLDLLTGKRVVSVQKDGRRIEYTAASLDELNRAINDAESVLGTTRCRRRPLGVRL
DSQ  ATGGTTACAGTCGCTGAACTGCAGGCGCTGCGTCAGGCGCGCCTTGATTTATTAACCGGTAAACGGGTGGTGTCTGTCCAGAAAGATGGTCGCAGAATTGAATATACGGCGGCTTCTCTGGATGAGCTTAACCGGGCGATCAATGATGCGGAGTCGGTACTGGGGACAACCCGGTGTCGCCGTCGTCCGCTGGGAGTGAGGTTA
TRN  10010101100011010
NAM  VHTJ_LAMBD/1-68
ASQ  MTRQEELAAARAALHDLMTGKRVATVQKDGRRVEFTATSVSDLKKYIAELEVQTGMTQRRRGPAGFYV
DSQ  ATGACGCGACAGGAAGAACTTGCCGCTGCCCGTGCGGCACTGCATGACCTGATGACAGGTAAACGGGTGGCAACAGTACAGAAAGACGGACGAAGGGTGGAGTTTACGGCCACTTCCGTGTCTGACCTGAAAAAATATATTGCAGAGCTGGAAGTGCAGACCGGCATGACACAGCGACGCAGGGGACCTGCAGGATTTTATGTA
TRN  10010101100011011
//