EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02792 - Mago_nashi)
FAM  PF02792
PID  Mago_nashi
DES  Mago nashi protein
IPR  IPR004023
ANO  3
ALN  143
AID  0.682551
APH  (MGN_SCHPO/3-145:0.36513,MGN_CAEEL/10-152:0.16897,MGN_ARATH/8-150:0.14913);
ATP  (MGN_SCHPO/3-145,MGN_CAEEL/10-152,MGN_ARATH/8-150);
ATL  0.68323
DNO  3
DLN  429
DID  0.613831
DPH  (MGN_SCHPO/3-145:0.40613,MGN_CAEEL/10-152:0.23108,MGN_ARATH/8-150:0.21356);
DTP  (MGN_SCHPO/3-145,MGN_CAEEL/10-152,MGN_ARATH/8-150);
DTL  0.85077
RID  0.682551
RPH  (MGN_SCHPO/3-145:0.36513,MGN_CAEEL/10-152:0.16897,MGN_ARATH/8-150:0.14913);
RTP  (MGN_SCHPO/3-145,MGN_CAEEL/10-152,MGN_ARATH/8-150);
RTL  0.68323
LNK  MGN_ARATH/8-150:O23676:U89959
LNK  MGN_CAEEL/10-152:P49029:Z81108
LNK  MGN_SCHPO/3-145:O43037:AL022070
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  MGN_SCHPO/3-145
ASQ  DFYVRYYSGHHGRFGHEFLEFDYHSDGLARYANNSNYRNDSLIRKEMFVSELVLKEVQRIVDDSEIIKESDESWPPENKDGKQELEIRMNGKHIMFETCKLGSLADVQNSDDPEGLKVFYYLIQDLKALCFSLISLNFKLRPV
DSQ  GATTTTTATGTTCGATACTACTCGGGACACCATGGTCGATTCGGACACGAGTTCTTGGAATTCGATTATCATAGTGATGGGCTAGCTAGATACGCAAACAATTCTAACTATCGGAACGATTCGTTAATCCGAAAGGAGATGTTCGTCAGTGAGCTTGTTTTAAAAGAAGTTCAACGTATTGTAGATGACAGTGAGATCATAAAAGAATCAGATGAAAGTTGGCCACCTGAAAATAAAGATGGTAAGCAGGAACTTGAAATTCGTATGAATGGAAAACACATCATGTTTGAAACCTGTAAACTTGGAAGTTTGGCAGACGTTCAAAATAGTGATGATCCAGAAGGGCTAAAAGTTTTCTACTACCTAATTCAAGATTTAAAAGCATTGTGCTTTAGTCTCATCTCCCTAAATTTTAAGCTCCGACCTGTT
TRN  10010101110011000
NAM  MGN_CAEEL/10-152
ASQ  DFYVRYYVGHKGKFGHEFLEFEFRPNGSLRYANNSNYKNDTMIRKEATVSESVLSELKRIIEDSEIMQEDDDNWPEPDKIGRQELEILYKNEHISFTTGKIGALADVNNSKDPDGLRSFYYLVQDLKCLVFSLIGLHFKIKPI
DSQ  GACTTTTACGTTCGTTACTACGTTGGACACAAGGGAAAATTCGGTCACGAATTTCTCGAATTCGAATTCCGTCCAAACGGATCGCTTCGCTACGCGAACAACTCCAACTACAAGAATGACACGATGATCCGCAAAGAGGCGACAGTGTCGGAATCGGTGCTCAGCGAGCTCAAGCGTATCATCGAAGACTCGGAAATCATGCAGGAGGACGATGACAATTGGCCAGAACCAGACAAGATTGGACGCCAGGAGCTGGAAATTCTGTACAAAAACGAGCACATCTCGTTTACGACCGGCAAAATCGGAGCTCTAGCCGATGTGAACAACTCGAAAGATCCGGATGGTCTCCGCTCGTTCTACTATCTCGTTCAGGATCTCAAGTGCCTCGTCTTCTCGCTCATTGGCCTTCACTTCAAGATCAAGCCAATC
TRN  11011101101011011
NAM  MGN_ARATH/8-150
ASQ  EFYLRYYVGHKGKFGHEFLEFEFREDGKLRYANNSNYKNDTIIRKEVFLTPAVLKECKRIVSESEILKEDDNNWPEPDRVGKQELEIVLGNEHISFATSKIGSLVDCQSSNDPEGLRIFYYLVQDLKCLVFSLISLHFKIKPI
DSQ  GAGTTCTACCTGAGATACTATGTCGGTCACAAAGGGAAATTTGGACACGAGTTCCTGGAGTTCGAGTTTAGAGAGGACGGTAAGCTCCGTTACGCCAATAACTCTAACTACAAGAACGATACTATTATCCGCAAGGAGGTATTTCTCACCCCCGCCGTGCTCAAGGAATGCAAGCGTATCGTCTCCGAGAGCGAGATTCTGAAAGAAGACGATAACAATTGGCCGGAACCTGACCGTGTTGGAAAGCAAGAGCTCGAGATCGTCTTGGGTAATGAGCATATCTCATTCGCTACATCTAAGATTGGATCTCTTGTTGATTGCCAGAGCAGTAATGATCCTGAAGGACTTCGCATCTTCTACTATCTTGTTCAGGACTTGAAATGTCTTGTTTTTTCGCTCATCTCTCTGCACTTCAAAATCAAGCCTATC
TRN  10010101100011001
//