EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02783 - MCR_beta_N)
FAM  PF02783
PID  MCR_beta_N
DES  Methyl-coenzyme M reductase beta subunit, N-terminal domain
IPR  IPR003179
ANO  7
ALN  186
AID  0.542707
APH  ((MCRY_METTH/1-186:0.22220,MCRY_METJA/2-187:0.12623):0.13070,(MCRB_METVO/2-187:0.37044,MCRB_METJA/5-190:0.19538):0.10043,((MCRB_METBA/1-183:0.58936,Q49601_METKA/3-188:0.31140):0.08234,MCRB_METTM/1-186:0.18720):0.16275);
ATP  ((MCRY_METTH/1-186,MCRY_METJA/2-187),(MCRB_METVO/2-187,MCRB_METJA/5-190),((MCRB_METBA/1-183,Q49601_METKA/3-188),MCRB_METTM/1-186));
ATL  2.47628
DNO  7
DLN  558
DID  0.569252
DPH  (((((MCRB_METBA/1-183:0.41613,Q49601_METKA/3-188:0.33569):0.06353,MCRB_METTM/1-186:0.20130):0.15506,MCRY_METTH/1-186:0.22515):0.13442,MCRY_METJA/2-187:0.15621):0.13020,MCRB_METVO/2-187:0.29124,MCRB_METJA/5-190:0.15740);
DTP  (((((MCRB_METBA/1-183,Q49601_METKA/3-188),MCRB_METTM/1-186),MCRY_METTH/1-186),MCRY_METJA/2-187),MCRB_METVO/2-187,MCRB_METJA/5-190);
DTL  2.26633
RID  0.542707
RPH  ((MCRY_METTH/1-186:0.22220,MCRY_METJA/2-187:0.12623):0.13070,(MCRB_METVO/2-187:0.37044,MCRB_METJA/5-190:0.19538):0.10043,((MCRB_METBA/1-183:0.58936,Q49601_METKA/3-188:0.31140):0.08234,MCRB_METTM/1-186:0.18720):0.16275);
RTP  ((MCRY_METTH/1-186,MCRY_METJA/2-187),(MCRB_METVO/2-187,MCRB_METJA/5-190),((MCRB_METBA/1-183,Q49601_METKA/3-188),MCRB_METTM/1-186));
RTL  2.47628
LNK  MCRB_METBA/1-183:P07955:Y00158
LNK  MCRB_METJA/5-190:Q58252:U67528
LNK  MCRB_METTM/1-186:P11560:X07794
LNK  MCRB_METVO/2-187:P11561:X07793
LNK  MCRY_METJA/2-187:Q60390:U67465
LNK  MCRY_METTH/1-186:P21111:U09990
LNK  Q49601_METKA/3-188:Q49601:U57340
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q49601_METKA/3-188
ASQ  REAKDTVDLYDDRGNCVAEEVPIEVLSPMRNEAIQSIVNDIKRTVAIDLEGIENALQNATVGGKGMKIPGREMDVDIVDNAEAIADEIEKMIRVYEDDDTNVEPMYDGKRLLVQLPSERVKVMADPYSGTLQAGMAVVHAIIDVCEVDMWDANMVKAAVFGRYPQTIDYFGGNVASMLDVPMKQEG
DSQ  CGCGAGGCCAAGGACACGGTCGATTTGTACGACGATCGCGGTAACTGTGTGGCGGAAGAAGTTCCCATCGAGGTGCTCTCTCCGATGCGCAACGAGGCCATTCAGAGTATCGTGAACGACATCAAGCGTACCGTCGCGATCGACCTCGAGGGTATCGAGAACGCCCTGCAGAACGCGACCGTCGGCGGTAAGGGGATGAAGATCCCGGGCCGCGAGATGGACGTCGACATCGTGGACAACGCCGAGGCGATCGCGGACGAGATCGAGAAGATGATCCGCGTGTACGAGGACGACGACACGAACGTGGAGCCCATGTACGACGGTAAGCGTCTCCTTGTGCAGCTCCCGTCCGAGCGTGTGAAGGTCATGGCCGACCCGTACTCCGGTACCCTGCAGGCCGGTATGGCGGTCGTGCACGCGATCATCGACGTCTGCGAGGTCGACATGTGGGACGCTAACATGGTCAAGGCGGCCGTCTTCGGTCGCTACCCGCAGACGATCGACTACTTCGGCGGTAACGTCGCCTCGATGCTGGACGTGCCGATGAAGCAGGAGGGT
TRN  11011111101111111
NAM  MCRB_METTM/1-186
ASQ  AKFEDKVDLYDDRGNLVEEQVPLEALSPLRNPAIKSIVQGIKRTVAVNLEGIENALKTAKVGGPACKIMGRELDLDIVGNAESIAAAAKEMIQVTEDDDTNVELLGGGKRALVQVPSARFDVAAEYSAAPLVTATAFVQAIINEFDVSMYDANMVKAAVLGRYPQSVEYMGANIATMLDIPQKLEG
DSQ  GCGAAGTTTGAGGATAAGGTCGACTTGTACGACGACAGAGGCAACCTCGTCGAAGAACAGGTGCCATTAGAAGCTCTAAGTCCATTAAGGAACCCCGCCATTAAAAGCATAGTGCAGGGGATTAAAAGGACAGTGGCTGTGAACCTTGAAGGTATAGAAAACGCCCTGAAGACAGCGAAGGTCGGCGGACCTGCCTGTAAGATAATGGGCCGTGAACTCGACCTCGACATTGTCGGGAACGCCGAGTCAATAGCAGCCGCTGCAAAGGAAATGATACAGGTGACTGAGGACGACGACACCAACGTCGAACTCCTTGGCGGAGGTAAAAGGGCACTCGTACAGGTCCCAAGTGCAAGGTTCGATGTTGCAGCAGAATACTCTGCAGCACCACTCGTAACCGCCACAGCATTTGTCCAGGCCATAATCAACGAGTTTGATGTTAGCATGTACGATGCTAACATGGTTAAAGCAGCCGTTCTGGGAAGATATCCACAGTCTGTGGAGTACATGGGGGCAAACATAGCAACAATGCTGGACATTCCACAGAAACTGGAAGGC
TRN  10010101100011000
NAM  MCRY_METJA/2-187
ASQ  LHYEDRIDLYDERGKLLEENVPLEAISPLKNPTIEKIVNDIKRSVAINLAGIENALKTGAVGGKACFCPGRELDLPIVENAEIIAEKIKRMVQIEEDDDTVVKLINGGKQLLLQLPSKRLRVAADYTVSALIGGGATVQAIVDAFDVDMFDAPVVKTAVMGRYPQTVDFHGANIATLLGPPVLLEG
DSQ  TTACATTATGAAGATAGAATAGATTTGTATGATGAAAGAGGAAAGTTGTTGGAGGAAAATGTTCCATTAGAAGCGATAAGTCCTCTAAAGAACCCAACAATTGAGAAAATAGTCAATGACATTAAGAGGAGCGTTGCTATAAACTTGGCAGGAATAGAAAACGCTTTAAAGACTGGAGCTGTTGGAGGAAAGGCATGTTTCTGTCCAGGGAGAGAGTTAGATTTACCAATTGTAGAAAACGCTGAAATTATTGCTGAAAAGATTAAAAGAATGGTTCAAATTGAAGAAGATGATGACACAGTTGTTAAGTTAATCAACGGAGGTAAGCAATTACTATTACAATTGCCATCAAAGAGGTTGAGAGTAGCTGCTGATTACACAGTATCAGCGCTGATTGGAGGAGGAGCAACTGTTCAGGCAATTGTTGATGCCTTTGATGTAGATATGTTTGACGCTCCTGTAGTAAAAACAGCAGTTATGGGGAGATACCCACAGACAGTAGATTTCCATGGTGCTAATATCGCTACATTATTAGGACCTCCAGTTTTATTGGAAGGA
TRN  10010101100011000
NAM  MCRY_METTH/1-186
ASQ  PMYEDRIDLYGADGKLLEEDVPLEAVSPLKNPTIANLVSDVKRSVAVNLAGIEGSLKKAALGGKSNFIPGREVELPIVENAEAIAEKVKRLVQTSEDDDTNIRLINNGQQILVQVPTTRMGVAADYTVSALVTGAAVVQAIIDEFDVDMFDANAVKTAVMGRYPQTVDFTGANLSTLLGPPVLLEG
DSQ  CCAATGTATGAAGACAGAATAGATCTCTACGGGGCAGATGGTAAGCTCCTCGAGGAAGATGTTCCTCTTGAAGCCGTAAGCCCCCTTAAAAACCCGACAATAGCAAACTTGGTAAGCGACGTGAAAAGGTCAGTTGCAGTGAACCTGGCCGGGATAGAGGGAAGCCTCAAGAAGGCAGCCCTGGGTGGAAAGTCCAACTTCATCCCGGGAAGGGAAGTTGAACTGCCAATAGTTGAAAACGCAGAGGCAATAGCTGAAAAGGTCAAAAGACTTGTTCAGACATCTGAAGACGACGACACAAACATCCGCCTCATAAACAACGGCCAGCAGATCCTCGTACAGGTCCCAACAACAAGGATGGGCGTGGCTGCAGACTACACAGTCTCAGCCCTGGTCACAGGAGCTGCAGTTGTACAGGCAATAATCGACGAATTCGACGTGGACATGTTCGATGCAAACGCAGTCAAAACCGCTGTCATGGGAAGATACCCACAGACAGTTGACTTCACAGGAGCCAACCTCTCAACACTCCTCGGACCACCAGTACTCCTCGAAGGT
TRN  10010101100011001
NAM  MCRB_METJA/5-190
ASQ  VKYKDTINLYDEKGKLVEENVPLEAISPLHNPTIQKLVKDVKRTVAVNLAGIENALRTGQVGGKGCMIKGRELDLPIVENAETIAEYVEKVVRVSEDDDTSIKLINDGKQMAVQIPSKRLDVAAEYSVSVLVTAQALKEAIIRTFDVDIFDAPMVHAAVLGGYPHEVTMKGSNIAALLGSPLSLEG
DSQ  GTAAAGTACAAAGACACAATAAACTTGTATGATGAAAAAGGTAAATTAGTAGAAGAAAACGTTCCTTTAGAAGCAATCAGCCCATTGCACAACCCAACAATTCAGAAGTTAGTTAAAGATGTTAAGAGAACAGTGGCAGTTAACTTAGCAGGTATTGAGAACGCTTTGAGAACTGGTCAAGTTGGTGGAAAAGGTTGTATGATTAAAGGTAGAGAGTTAGATTTACCAATTGTTGAAAATGCTGAAACAATTGCTGAATACGTTGAAAAAGTTGTTAGAGTTTCAGAAGATGACGACACATCAATTAAATTAATTAACGATGGAAAACAGATGGCTGTTCAAATTCCATCAAAGAGGTTAGATGTTGCAGCAGAATATTCAGTCTCTGTTTTAGTTACAGCTCAAGCATTAAAAGAAGCTATTATTAGAACATTTGATGTTGATATCTTCGATGCTCCAATGGTTCATGCAGCTGTTTTAGGTGGCTACCCACACGAAGTTACAATGAAAGGTTCAAACATCGCTGCATTATTAGGTAGCCCATTATCATTAGAAGGG
TRN  10010101110011000
NAM  MCRB_METVO/2-187
ASQ  VKYEDKICLFDAKGNQVAEDVPLEAISPLNNPTIMGMVKNIKRTVAVNLAGIEESLAKGKIGGKGCQVPGTNIELDVIGDAEAIADKVKSILQVSAGDDTEVKLINGGKQMAEQVPSKRLDVAAEYSVSMLSTGMALKEALITNFNIDMFDGSTVHSAIMGQYPQDMDYAGGNIASLLGAPSKLEG
DSQ  GTAAAGTATGAAGATAAGATATGTCTATTTGATGCGAAAGGAAACCAAGTAGCAGAAGATGTACCATTGGAAGCTATCAGCCCATTAAATAACCCAACTATAATGGGGATGGTTAAAAATATTAAAAGAACCGTTGCTGTTAACTTAGCTGGTATTGAAGAATCATTAGCTAAAGGTAAAATTGGCGGTAAAGGTTGCCAGGTTCCTGGTACAAATATAGAATTAGATGTTATAGGCGATGCAGAAGCTATCGCTGACAAAGTAAAAAGTATATTGCAAGTTTCAGCTGGCGATGATACCGAAGTTAAATTAATTAACGGCGGTAAACAGATGGCTGAGCAAGTACCTTCAAAAAGATTAGATGTTGCTGCAGAATACTCAGTATCAATGTTGTCAACTGGTATGGCTTTAAAAGAAGCTCTTATCACAAACTTCAACATTGACATGTTTGACGGTTCAACAGTACACTCAGCTATCATGGGTCAATATCCACAAGATATGGACTACGCTGGTGGTAACATTGCATCATTATTAGGTGCTCCATCAAAATTAGAAGGT
TRN  10010101110011000
NAM  MCRB_METBA/1-183
ASQ  ---SDTVDIYDDRGKLLESNVDIMSLAPTRNAAIQSIIMDTKRSVAVNLAGIQGALASGKMGGKGRQILGRGLNYDIVGNADAIAENVKKLVQVDEGDDTNVIKVKGGKSLLIQSPKSRIIAGADFMSATTVGAAAVTQTIMDMFGTDPYDAPIVKSAVWGSYPQTMDLMGGQVQGILSIPQNNEG
DSQ  ---------TCTGACACAGTAGACATCTACGACGACAGAGGAAAACTGCTCGAGAGCAATGTCGACATTATGAGCCTTGCTCCAACAAGAAACGCAGCAATTCAATCGATCATCATGGACACTAAGAGGTCAGTTGCAGTCAACCTCGCAGGTATTCAGGGTGCACTTGCCAGCGGCAAGATGGGCGGAAAGGGCCGTCAAATCTTAGGCCGCGGACTTAACTATGACATTGTAGGCAATGCTGATGCAATTGCAGAAAATGTTAAAAAACTCGTCCAGGTCGATGAAGGCGACGATACCAATGTTATCAAAGTCAAAGGCGGAAAGAGCCTCTTGATCCAGTCCCCCAAATCCAGGATTATTGCAGGCGCCGACTTCATGTCCGCAACAACAGTTGGTGCAGCAGCAGTCACCCAGACTATTATGGACATGTTTGGAACTGATCCTTATGATGCTCCTATCGTAAAATCAGCTGTCTGGGGAAGCTACCCACAGACAATGGATCTCATGGGAGGTCAGGTTCAGGGTATTCTCAGCATCCCCCAGAACAATGAAGGT
TRN  10010101100011000
//