EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02760 - HIN)
FAM  PF02760
PID  HIN
DES  HIN-200/IF120x domain
IPR  IPR004021
ANO  8
ALN  171
AID  0.4996
APH  ((((((II2A_MOUSE/57-224:0.39052,IFI4_MOUSE/245-415:0.19160):0.12554,IF16_HUMAN/200-370:0.31469):0.04968,MNDA_HUMAN/208-375:0.21767):0.19095,AIM2_HUMAN/149-318:0.54191):0.15922,IF16_HUMAN/574-741:0.30172):0.22903,II2A_MOUSE/255-422:0.52543,IFI3_MOUSE/202-369:0.18973);
ATP  ((((((II2A_MOUSE/57-224,IFI4_MOUSE/245-415),IF16_HUMAN/200-370),MNDA_HUMAN/208-375),AIM2_HUMAN/149-318),IF16_HUMAN/574-741),II2A_MOUSE/255-422,IFI3_MOUSE/202-369);
ATL  3.43358
DNO  7
DLN  513
DID  0.620955
DPH  ((II2A_MOUSE/57-224:0.18166,IFI4_MOUSE/245-415:0.09205):0.12426,MNDA_HUMAN/208-375:0.14721,((AIM2_HUMAN/149-318:0.33409,(II2A_MOUSE/255-422:0.25378,IFI3_MOUSE/202-369:0.12056):0.24659):0.08572,IF16_HUMAN/200-370:0.15693):0.04122);
DTP  ((II2A_MOUSE/57-224,IFI4_MOUSE/245-415),MNDA_HUMAN/208-375,((AIM2_HUMAN/149-318,(II2A_MOUSE/255-422,IFI3_MOUSE/202-369)),IF16_HUMAN/200-370));
DTL  1.78407
RID  0.494227
RPH  (MNDA_HUMAN/208-375:0.21409,((II2A_MOUSE/57-224:0.38843,IFI4_MOUSE/245-415:0.19454):0.14937,IF16_HUMAN/200-370:0.28532):0.06042,((II2A_MOUSE/255-422:0.48082,IFI3_MOUSE/202-369:0.23829):0.34793,AIM2_HUMAN/149-318:0.52062):0.17707);
RTP  (MNDA_HUMAN/208-375,((II2A_MOUSE/57-224,IFI4_MOUSE/245-415),IF16_HUMAN/200-370),((II2A_MOUSE/255-422,IFI3_MOUSE/202-369),AIM2_HUMAN/149-318));
RTL  3.0569
LNK  AIM2_HUMAN/149-318:O14862:AF024714
LNK  IF16_HUMAN/200-370:Q16666:M63838
LNK  IF16_HUMAN/574-741:Q16666:
LNK  IFI3_MOUSE/202-369:O35368:AF022371
LNK  IFI4_MOUSE/245-415:P15092:M31419
LNK  II2A_MOUSE/255-422:P15091:M31418
LNK  II2A_MOUSE/57-224:P15091:M31418
LNK  MNDA_HUMAN/208-375:P41218:M81750
AMK  .xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  ...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  IFI4_MOUSE/245-415
ASQ  lHSEPLTVMVLTATDPFEYESPEHEVKNMLHATVATVSQYFHVKVFNINLKEKFTKKNFIIISNYFESKGILEINETSSVLEAAPDQMIEVPNSIIRNANASPKICDIQKGTSGAVFYGVFTLHKKTVNRKNTIYEIKDGSGSIEVVGSGKWHNINCKEGDKLHLFCFHLK
DSQ  ctcCACTCAGAGCCCCTGACAGTGATGGTGCTCACTGCAACAGACCCATTTGAATATGAATCACCAGAACATGAAGTAAAGAACATGCTTCATGCTACAGTGGCTACAGTGAGCCAGTATTTCCATGTGAAAGTTTTCAACATCAACTTGAAAGAAAAGTTCACAAAAAAGAATTTTATCATCATATCCAATTACTTTGAGAGCAAAGGCATCCTGGAGATCAATGAGACTTCCTCTGTGTTAGAGGCTGCTCCTGACCAAATGATTGAAGTGCCCAACAGTATTATCAGAAATGCAAATGCCAGTCCTAAGATCTGTGATATTCAAAAGGGTACTTCTGGAGCAGTGTTCTATGGAGTGTTTACATTACACAAGAAAACAGTGAACCGAAAGAACACAATCTATGAAATAAAAGATGGTTCAGGAAGCATAGAAGTGGTGGGGAGTGGAAAATGGCACAACATCAACTGCAAGGAAGGAGATAAACTCCACCTCTTCTGCTTTCACCTGAAA
TRN  10010101100011000
NAM  MNDA_HUMAN/208-375
ASQ  .QNDPVTVVVLKATAPFKYESPENGKSTMFHATVASKTQYFHVKVFDINLKEKFVRKKVITISDYSECKGVMEIKEASSVSDF--NQNFEVPNRIIEIANKTPKISQLYKQASGTMVYGLFMLQKKSVHKKNTIYEIQDNTGSMDVVGSGKWHNIKCEKGDKLRLFCLQLR
DSQ  ...CAAAACGACCCAGTGACAGTGGTGGTACTGAAAGCAACAGCGCCATTTAAATACGAGTCCCCAGAAAATGGGAAAAGCACAATGTTTCATGCTACAGTGGCCAGTAAGACTCAATATTTCCATGTGAAAGTCTTCGACATCAACTTGAAAGAGAAATTTGTAAGGAAGAAGGTCATTACCATATCTGATTACTCTGAATGTAAAGGAGTAATGGAAATAAAGGAAGCATCATCTGTGTCTGACTTT------AATCAAAATTTTGAGGTCCCAAACAGAATTATCGAAATAGCAAATAAAACTCCCAAGATCAGTCAACTTTACAAGCAAGCATCTGGAACAATGGTGTATGGGTTGTTTATGTTACAAAAGAAAAGCGTACACAAGAAGAACACAATTTATGAAATACAGGATAATACAGGATCCATGGATGTAGTGGGGAGTGGAAAATGGCACAATATCAAGTGTGAGAAAGGAGATAAACTTCGACTCTTCTGCCTTCAACTGAGA
TRN  10010101100011000
NAM  IF16_HUMAN/200-370
ASQ  lQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRLR
DSQ  ctcCAAAAACGCCCAGTGATAGTGAAGGTACTGAGTACAACAAAGCCATTTGAATATGAGACCCCAGAAATGGAGAAAAAAATAATGTTTCATGCTACAGTGGCTACACAGACACAGTTCTTCCATGTGAAGGTTTTAAACACCAGCTTGAAGGAGAAATTCAATGGAAAGAAAATCATCATCATATCAGATTATTTGGAATATGATAGTCTCCTAGAGGTCAATGAAGAATCTACTGTATCTGAAGCTGGTCCTAACCAAACGTTTGAGGTTCCAAATAAAATCATCAACAGAGCAAAGGAAACTCTGAAGATTGATATTCTTCACAAACAAGCTTCAGGAAATATTGTATATGGGGTATTTATGCTACATAAGAAAACAGTAAATCAGAAGACCACAATCTACGAAATTCAGGATGATAGAGGAAAAATGGATGTAGTGGGGACAGGACAATGTCACAATATCCCCTGTGAAGAAGGAGATAAGCTCCAGCTTTTCTGCTTTCGACTTAGA
TRN  10010101100011000
NAM  II2A_MOUSE/57-224
ASQ  lHEKPMTVMVLTATEPFNYKEG---KENMFHATVATESQYYRVKVFNMDLKEKFTENKFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSFHLR
DSQ  cttCATGAGAAACCCATGACAGTGATGGTACTCACTGCAACAGAACCATTTAATTATAAAGAGGGA---------AAAGAGAACATGTTTCATGCTACAGTGGCTACAGAGAGCCAATATTACCGTGTGAAAGTTTTCAACATGGACTTGAAAGAGAAGTTCACAGAAAATAAATTTATTACCATTTCCAAATACTTCAACAGCAGTGGCATCCTAGAGATCAATGAAACTGCCACTGTGTCAGAGGCTGCTCCTAACCAAATGTTTGAAGTGCCCAAAAATATTATCAGAAGTGCAAAAGAAACTCTTAAGATCTCTAAAATTAAAGAACTTGATTCTGGAACACTGATTTATGGTGTGTTTGCAGTAGAGAAGAAAAAAGTGAATGATAAAAGTATAACCTTCAAAATAAAAGATAATGAAGATAATATAAAAGTGGTGTGGGATAAAGAACAGCACAATATCAACTATGAGAAAGGAGATAAACTCCAACTCTTCTCCTTTCACCTGAGA
TRN  10010101100011001
NAM  IF16_HUMAN/574-741
ASQ  .QSDLKEVMVLNATESFVYEPKE-QKK-MFHATVATENEVFRVKVFNIDLKEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLNTINCEEGDKLKLTSFELA
NAM  IFI3_MOUSE/202-369
ASQ  .HQGPKQVMVLKVTEPFTYDFEE-TKR-MFHATVATETEFFRVKVFDTALMSKFIPGKIIAISHYIGCNGFLEIYRASCVSDVNINPTMIISNTLSESAIATPKISYLLSQAKGTFVNGEFVVFKKSERHECICYGIGDDTGKMAVVVYGRLTNVRCEPGSKLRLVCFELT
DSQ  ...CATCAAGGTCCCAAACAAGTGATGGTGTTGAAAGTAACAGAACCATTTACATATGACTTTGAAGAA---ACGAAAAGG---ATGTTTCATGCTACAGTGGCTACTGAAACTGAGTTCTTCAGAGTGAAGGTTTTTGATACAGCTCTAATGAGCAAGTTCATCCCAGGAAAGATCATTGCCATATCACATTATATTGGGTGCAATGGGTTTCTGGAGATATACAGAGCTTCCTGTGTGTCCGATGTGAACATTAACCCAACAATGATTATCTCAAATACACTGAGTGAAAGTGCTATTGCAACTCCAAAAATTTCTTATCTTCTCTCACAAGCAAAGGGGACATTTGTAAATGGAGAATTTGTAGTATTTAAGAAAAGTGAGAGGCATGAGTGCATTTGCTATGGAATTGGAGATGATACAGGAAAAATGGCAGTGGTGGTTTATGGACGACTCACCAATGTCAGGTGTGAACCAGGCAGTAAACTTAGACTTGTCTGCTTTGAATTGACT
TRN  10010101100011001
NAM  AIM2_HUMAN/149-318
ASQ  fQKRCLPVMVLKAKKPFTFETQE-GKQEMFHATVATEKEFFFVKVFNTLLKDKFIPKRIIIIARYYRHSGFLEVNSASRVLDAESDQKVNVPLNIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGVRNEDTMKCKEGDKVRLTFFTLS
DSQ  tttCAGAAGCGCTGTTTGCCAGTTATGGTACTGAAAGCAAAGAAGCCCTTCACGTTTGAGACCCAAGAA---GGCAAGCAGGAGATGTTTCATGCTACAGTGGCTACAGAAAAGGAATTCTTCTTTGTAAAAGTTTTTAATACACTGCTGAAAGATAAATTCATTCCAAAGAGAATAATTATAATAGCAAGATATTATCGGCACAGTGGTTTCTTAGAGGTAAATAGCGCCTCACGTGTGTTAGATGCTGAATCTGACCAAAAGGTTAATGTCCCGCTGAACATTATCAGAAAAGCTGGTGAAACCCCGAAGATCAACACGCTTCAAACTCAGCCCCTTGGAACAATTGTGAATGGTTTGTTTGTAGTCCAGAAGGTAACAGAAAAGAAGAAAAACATATTATTTGACCTAAGTGACAACACTGGGAAAATGGAAGTACTGGGGGTTAGAAACGAGGACACAATGAAATGTAAGGAAGGAGATAAGGTTCGACTTACATTCTTCACACTGTCA
TRN  10010101100011000
NAM  II2A_MOUSE/255-422
ASQ  yHKGPKQVVALKATKLFTYDSI-KSKK-MFHATVATDTEFFRVMVFEENLEKKFIPGNTIALSDYFGMYGSLAIHEYSSVSEV-KSQNKEDSSSSDERPIEHLKICDLHLQTEERLFDGEFKVYRKSSGNNCICYGIWDDTGAMKVVVSGQLTSVNCEIGNTIRLVCFELT
DSQ  tacCACAAAGGTCCCAAACAAGTGGTGGCATTGAAAGCAACAAAACTATTTACTTATGATAGTATA---AAAAGTAAAAAG---ATGTTCCATGCCACAGTGGCTACTGATACAGAATTCTTCAGAGTGATGGTGTTCGAGGAAAACCTAGAGAAAAAGTTTATCCCGGGAAACACCATTGCTTTATCAGATTATTTTGGTATGTATGGGTCTCTGGCAATACATGAATATTCCAGCGTGTCTGAGGTG---AAGAGCCAAAATAAGGAAGACTCAAGTTCATCAGATGAAAGACCCATAGAACATCTTAAAATTTGTGATCTTCACTTGCAAACAGAAGAAAGGCTGTTTGATGGAGAGTTTAAAGTATACAGGAAAAGTTCCGGAAATAATTGTATATGCTATGGAATTTGGGATGATACAGGAGCAATGAAAGTGGTGGTATCTGGACAACTGACCAGTGTCAACTGTGAGATTGGTAATACAATTAGACTTGTCTGCTTTGAATTGACC
TRN  10010101100011000
//