EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02750 - Synapsin_C)
FAM  PF02750
PID  Synapsin_C
DES  Synapsin, ATP binding domain
IPR  IPR001359
ANO  4
ALN  203
AID  0.718883
APH  ((SYN2_HUMAN/214-416:0.07763,SYN3_RAT/192-394:0.21369):0.02492,SYN1_RAT/214-416:0.13803,O76322_LOLPE/191-393:0.27824);
ATP  ((SYN2_HUMAN/214-416,SYN3_RAT/192-394),SYN1_RAT/214-416,O76322_LOLPE/191-393);
ATL  0.73251
DNO  4
DLN  609
DID  0.693487
DPH  (SYN2_HUMAN/214-416:10.96029,(SYN1_RAT/214-416:13.58201,O76322_LOLPE/191-393:35.39974):6.42428,SYN3_RAT/192-394:19.16449);
DTP  (SYN2_HUMAN/214-416,(SYN1_RAT/214-416,O76322_LOLPE/191-393),SYN3_RAT/192-394);
DTL  85.5393
RID  0.718883
RPH  ((SYN2_HUMAN/214-416:0.07763,SYN3_RAT/192-394:0.21369):0.02492,SYN1_RAT/214-416:0.13803,O76322_LOLPE/191-393:0.27824);
RTP  ((SYN2_HUMAN/214-416,SYN3_RAT/192-394),SYN1_RAT/214-416,O76322_LOLPE/191-393);
RTL  0.73251
LNK  O76322_LOLPE/191-393:O76322:AF055373
LNK  SYN1_RAT/214-416:P09951:M27812
LNK  SYN2_HUMAN/214-416:Q92777:U40215
LNK  SYN3_RAT/192-394:O70441:AF056704
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O76322_LOLPE/191-393
ASQ  NSFHSIYNFQDKPWTMAHLIQIQKKVGAENFPLIEQAYYPNHKEMLVTPKFPVVVKIGHAHSGMGKVKVDHHHAFQDIASVVAVTKSYATTEPYIDCKCDIHVQKIGNNYKAFLRKSISGNWKANTGSAMLEQIQMNEKYKLWVDECSQLFGGLDIVAVEALQGKDGREYIIEVNDSSMALLGETQEEDRRLIAEMVLQKMHM
DSQ  AATTCATTTCATTCGATTTATAACTTCCAAGACAAACCTTGGACTATGGCTCACTTGATTCAAATTCAGAAGAAAGTCGGTGCTGAAAATTTCCCCCTTATTGAACAAGCCTACTACCCCAATCATAAGGAAATGTTGGTTACTCCGAAATTTCCTGTTGTGGTAAAAATTGGCCATGCACATTCCGGGATGGGAAAAGTGAAGGTTGATCACCACCACGCATTTCAAGATATTGCTAGTGTTGTTGCTGTCACCAAATCTTATGCGACTACAGAACCATACATTGACTGCAAGTGTGACATACACGTGCAAAAAATTGGAAACAACTATAAGGCGTTTCTCCGTAAATCTATATCAGGCAACTGGAAAGCCAACACAGGTTCTGCAATGTTAGAACAAATACAAATGAATGAAAAGTACAAACTTTGGGTTGATGAGTGCAGTCAACTTTTTGGTGGACTTGATATTGTTGCTGTTGAGGCTCTCCAAGGAAAAGATGGGCGCGAGTATATTATTGAGGTTAATGATTCTTCAATGGCTTTACTCGGAGAAACCCAGGAAGAGGATCGACGTCTTATAGCAGAAATGGTTTTACAGAAAATGCACATG
TRN  10010101110011000
NAM  SYN2_HUMAN/214-416
ASQ  NSLESIYNFCDKPWVFAQLVAIYKTLGGEKFPLIEQTYYPNHKEMLTLPTFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQTYATAEPFIDSKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITELVISKMNQ
DSQ  AACTCACTGGAATCCATATACAACTTCTGTGACAAGCCATGGGTGTTTGCCCAGCTGGTCGCTATCTATAAGACACTGGGAGGAGAAAAGTTCCCTCTCATTGAACAGACATACTACCCCAACCACAAAGAGATGCTGACACTGCCCACGTTCCCTGTGGTGGTGAAGATTGGCCACGCTCACTCAGGCATGGGCAAGGTCAAAGTGGAAAACCACTACGACTTCCAGGACATTGCCAGCGTGGTGGCTCTCACCCAGACCTATGCCACTGCAGAGCCTTTCATTGACTCCAAGTATGACATCCGGGTCCAGAAGATTGGCAACAACTACAAGGCTTATATGAGGACATCGATCTCAGGGAACTGGAAGACGAACACTGGCTCTGCGATGCTGGAGCAGATTGCCATGTCAGACAGGTACAAACTGTGGGTGGACACCTGCTCTGAGATGTTTGGCGGCCTGGACATCTGTGCTGTCAAAGCTGTACATGGCAAAGATGGGAAAGACTACATTTTTGAGGTCATGGACTGTAGCATGCCACTGATTGGGGAACATCAGGTGGAGGACAGGCAACTCATCACCGAACTAGTCATCAGCAAGATGAACCAG
TRN  10010101100011001
NAM  SYN1_RAT/214-416
ASQ  NSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMTQ
DSQ  AACTCTTTGCATTCTGTCTACAACTTTTGTGACAAACCCTGGGTGTTTGCCCAGATGGTTCGACTACACAAGAAGCTTGGAACAGAGGAATTCCCTCTGATTGATCAGACTTTCTATCCCAATCATAAAGAGATGCTCAGCAGCACAACATACCCTGTAGTTGTGAAGATGGGCCACGCACACTCTGGGATGGGCAAGGTCAAGGTAGACAACCAACATGACTTCCAGGATATTGCAAGTGTTGTGGCACTGACTAAGACATATGCCACTGCTGAGCCCTTCATTGATGCTAAATACGATGTGCGTGTCCAGAAGATTGGGCAGAACTACAAGGCCTACATGAGGACATCAGTGTCAGGGAACTGGAAGACCAATACAGGCTCTGCTATGCTTGAGCAGATTGCTATGTCTGACAGGTACAAGTTGTGGGTAGACACGTGCTCAGAGATTTTTGGGGGACTTGACATCTGCGCAGTGGAAGCACTGCATGGCAAGGACGGAAGGGATCACATTATTGAGGTGGTGGGCTCCTCCATGCCACTCATTGGGGATCACCAGGATGAAGACAAGCAGCTCATCGTGGAACTTGTGGTCAACAAGATGACTCAG
TRN  10010101100011001
NAM  SYN3_RAT/192-394
ASQ  NSLYSVYNFCSKPWVFSQLIKIFHSLGPEKFPLVEQTFFPNHKPMLTAPNFPVVIKLGHAHAGMGKIKVENQHDYQDITSVVAMAKTYATTEAFIDSKYDIRIQKIGSNYKAYMRTSISGNWKANTGSAMLEQVAMTERYRLWVDSCSEMFGGLDICAVKAVHSKNGRDYIIEVMDSSMPLIGEHVEEDKQLMADLVVSKMSQ
DSQ  AACTCTCTCTACTCCGTATACAACTTCTGCAGCAAGCCTTGGGTGTTCTCTCAGCTCATTAAGATCTTCCATTCCTTGGGTCCTGAGAAGTTTCCACTAGTGGAGCAAACATTTTTCCCCAACCACAAGCCAATGCTCACAGCCCCGAACTTCCCTGTGGTGATCAAGCTGGGACACGCTCATGCTGGCATGGGAAAGATCAAAGTAGAAAACCAGCACGACTACCAGGACATCACCAGCGTGGTGGCCATGGCCAAAACCTATGCCACCACGGAGGCCTTTATTGACTCCAAGTATGACATCCGCATACAGAAGATCGGATCCAACTACAAGGCATACATGAGAACCTCCATCTCTGGAAACTGGAAGGCCAACACAGGCTCTGCTATGCTGGAGCAGGTGGCCATGACGGAAAGGTACAGGCTGTGGGTGGACAGCTGCTCAGAAATGTTCGGCGGCCTAGACATCTGTGCTGTCAAGGCCGTTCACAGCAAGAATGGCAGAGATTATATCATTGAGGTCATGGACAGTTCAATGCCACTGATTGGAGAACATGTGGAGGAGGACAAGCAGTTAATGGCTGACCTTGTTGTTTCCAAGATGAGCCAA
TRN  10010101100011000
//