EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02748 - PyrI_C)
FAM  PF02748
PID  PyrI_C
DES  Aspartate carbamoyltransferase regulatory chain, metal binding domain
IPR  IPR002801
ANO  9
ALN  56
AID  0.37303
APH  ((((PYRI_METJA/100-148:0.50246,(((PYRI_ARCFU/99-152:0.84062,PYRI_SULAC/105-156:0.52826):0.04437,PYRI_METTH/103-154:0.40184):0.21955,PYRI_PYRAB/100-150:0.12893):0.18396):0.31171,PYRB_THEMA/473-526:1.21229):0.38843,PYRI_SERMA/100-151:0.16537):0.21409,PYRI_SALTY/100-151:0.14727,PYRI_VIBS2/100-151:0.49920);
ATP  ((((PYRI_METJA/100-148,(((PYRI_ARCFU/99-152,PYRI_SULAC/105-156),PYRI_METTH/103-154),PYRI_PYRAB/100-150)),PYRB_THEMA/473-526),PYRI_SERMA/100-151),PYRI_SALTY/100-151,PYRI_VIBS2/100-151);
ATL  5.78831
DNO  9
DLN  168
DID  0.480367
DPH  ((((((PYRI_PYRAB/100-150:0.24154,(PYRI_SULAC/105-156:0.22232,PYRI_METJA/100-148:0.40611):0.14445):0.10295,PYRI_ARCFU/99-152:0.39799):0.02752,PYRI_METTH/103-154:0.33442):0.21877,PYRB_THEMA/473-526:0.58530):0.19318,PYRI_VIBS2/100-151:0.41503):0.22199,PYRI_SERMA/100-151:0.25403,PYRI_SALTY/100-151:0.23104);
DTP  ((((((PYRI_PYRAB/100-150,(PYRI_SULAC/105-156,PYRI_METJA/100-148)),PYRI_ARCFU/99-152),PYRI_METTH/103-154),PYRB_THEMA/473-526),PYRI_VIBS2/100-151),PYRI_SERMA/100-151,PYRI_SALTY/100-151);
DTL  3.99664
RID  0.37303
RPH  ((((PYRI_METJA/100-148:0.50246,(((PYRI_ARCFU/99-152:0.84062,PYRI_SULAC/105-156:0.52826):0.04437,PYRI_METTH/103-154:0.40184):0.21955,PYRI_PYRAB/100-150:0.12893):0.18396):0.31171,PYRB_THEMA/473-526:1.21229):0.38843,PYRI_SERMA/100-151:0.16537):0.21409,PYRI_SALTY/100-151:0.14727,PYRI_VIBS2/100-151:0.49920);
RTP  ((((PYRI_METJA/100-148,(((PYRI_ARCFU/99-152,PYRI_SULAC/105-156),PYRI_METTH/103-154),PYRI_PYRAB/100-150)),PYRB_THEMA/473-526),PYRI_SERMA/100-151),PYRI_SALTY/100-151,PYRI_VIBS2/100-151);
RTL  5.78831
LNK  PYRB_THEMA/473-526:P96111:AE001806
LNK  PYRI_ARCFU/99-152:O30129:AE001099
LNK  PYRI_METJA/100-148:Q58801:U67581
LNK  PYRI_METTH/103-154:O26938:AE000861
LNK  PYRI_PYRAB/100-150:P77919:U61765
LNK  PYRI_SALTY/100-151:P08421:X05641
LNK  PYRI_SERMA/100-151:P19936:J05033
LNK  PYRI_SULAC/105-156:P74766:Y08309
LNK  PYRI_VIBS2/100-151:P96175:Y09786
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  PYRI_METTH/103-154
ASQ  DEVRG--ILRCPNPNCITNSDEGVEN-RFYVISEEP-VLLRCYYCERLIEADEIES
DSQ  GATGAGGTGAGGGGC------ATCCTCAGATGTCCCAACCCCAACTGCATCACAAACAGTGACGAGGGTGTTGAGAAC---CGTTTCTATGTCATCTCAGAGGAACCC---GTTCTCCTACGCTGCTACTACTGTGAGCGCCTCATTGAGGCTGATGAGATAGAGTCA
TRN  10010101110011001
NAM  PYRI_PYRAB/100-150
ASQ  DVIEG--ILRCGNPNCITNHEYVTT--KFYVISREP-LKVRCHYCERTMEEEEILA
DSQ  GACGTTATAGAGGGA------ATACTGAGGTGTGGCAATCCAAACTGCATAACCAACCACGAATACGTTACAACG------AAGTTCTACGTTATAAGTAGGGAACCT---CTAAAGGTTCGTTGTCACTACTGTGAAAGAACAATGGAAGAGGAGGAGATACTGGCT
TRN  10010101100011011
NAM  PYRI_METJA/100-148
ASQ  DEIEG--TLKCTNPNCITNKEKVRG--KFKIESKNP-LKIRCYYCEKFLN--EVIF
DSQ  GATGAGATAGAAGGG------ACATTAAAATGCACAAATCCAAATTGCATAACAAATAAAGAAAAAGTTAGAGGA------AAATTTAAAATAGAAAGTAAAAACCCA---TTAAAAATTAGATGCTATTATTGTGAGAAGTTTTTAAAT------GAAGTAATTTTT
TRN  10010101110011010
NAM  PYRI_SULAC/105-156
ASQ  KVVKG--ILKCPNPYCITSNDVEAI-PTFKTLTEKP-LKMRCEYCETIIDENEIMS
DSQ  AAGGTGGTAAAGGGA------ATACTGAAATGTCCAAATCCTTACTGCATAACGAGTAATGATGTGGAAGCTATT---CCCACTTTCAAAACATTGACGGAAAAACCA---TTAAAAATGAGATGTGAGTATTGTGAGACAATAATTGACGAGAACGAGATAATGAGC
TRN  10010101100011010
NAM  PYRI_ARCFU/99-152
ASQ  EVVEG--VLKCPNHACISNAEREPITPKFYIKTEEMRATARCHYCGRKIENLDNYI
DSQ  GAGGTGGTGGAGGGA------GTGCTCAAATGCCCCAACCACGCCTGCATTTCCAATGCTGAAAGGGAGCCGATAACACCCAAGTTTTACATCAAAACGGAAGAAATGAGGGCAACGGCAAGGTGCCACTACTGCGGGAGGAAAATAGAAAATCTTGATAATTACATA
TRN  10010101110011011
NAM  PYRB_THEMA/473-526
ASQ  PTIYGFEELRCKNENCITNPAHGENASPSFVRNEKG--QFICEYCETPHSFEEIWS
DSQ  CCAACGATCTATGGATTCGAAGAGCTCCGATGCAAAAACGAGAACTGTATCACCAATCCCGCACACGGTGAAAATGCTTCACCTTCCTTTGTGAGAAACGAAAAAGGA------CAGTTCATATGCGAGTACTGTGAAACACCGCATTCTTTCGAAGAGATCTGGAGT
TRN  10010101110011001
NAM  PYRI_VIBS2/100-151
ASQ  KEVEN--VFPCPNSNCITHGEPVIS--SFTIKMIKGNIGLKCKYCEKTFSKEIVTA
DSQ  AAAGAAGTTGAAAAT------GTGTTCCCATGTCCAAATTCAAATTGTATTACGCATGGAGAACCGGTTATTTCA------TCTTTTACCATTAAAATGATCAAAGGTAATATCGGTCTAAAATGTAAGTATTGTGAAAAAACATTCTCAAAAGAAATTGTAACTGCA
TRN  11011101111011001
NAM  PYRI_SALTY/100-151
ASQ  ERINN--VLVCPNSNCISHAEPVSS--SFAVKKRANDIALKCKYCEKEFSHYVVLA
DSQ  GAGCGTATTAATAAT------GTGCTGGTTTGCCCGAACAGCAACTGCATCAGCCACGCGGAACCAGTATCCTCC------AGCTTTGCAGTGAAAAAACGGGCCAATGATATCGCCCTCAAATGCAAATACTGTGAAAAAGAGTTTTCGCATTATGTGGTGCTGGCC
TRN  11011101101011011
NAM  PYRI_SERMA/100-151
ASQ  DHIDG--VLTCPNGNCISRSEPVRS--SFSVKSRGGEVHLKCRYCEKEFEHQVVLQ
DSQ  GACCACATCGACGGC------GTGCTGACCTGCCCGAACGGCAACTGCATCAGCCGCAGCGAGCCGGTGCGGTCG------AGCTTCAGCGTCAAATCGCGCGGCGGCGAAGTGCACCTGAAATGCCGCTACTGCGAAAAAGAGTTCGAGCATCAGGTGGTGTTGCAG
TRN  11011101101011011
//