EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02744 - GalP_UDP_tr_C)
FAM  PF02744
PID  GalP_UDP_tr_C
DES  Galactose-1-phosphate uridyl transferase, C-terminal domain
IPR  IPR005850
ANO  10
ALN  221
AID  0.335899
APH  (((GALT_BACSU/236-451:0.04820,(GALT_STRMU/227-435:0.26627,GALT_LACHE/223-431:0.40895):0.38563):2.67148,(GAL7_KLULA/191-363:0.15576,GAL7_YEAST/193-365:0.25575):0.12558):0.04002,(GAL7_CRYNE/200-373:0.30639,GAL7_STRLI/179-354:1.15685):0.15345,(GAL7_HUMAN/198-370:0.32413,(GAL7_ECOLI/178-347:0.21742,GAL7_HAEIN/179-348:0.12972):0.07438):0.20267);
ATP  (((GALT_BACSU/236-451,(GALT_STRMU/227-435,GALT_LACHE/223-431)),(GAL7_KLULA/191-363,GAL7_YEAST/193-365)),(GAL7_CRYNE/200-373,GAL7_STRLI/179-354),(GAL7_HUMAN/198-370,(GAL7_ECOLI/178-347,GAL7_HAEIN/179-348)));
ATL  6.92265
DNO  9
DLN  663
DID  0.438451
DPH  (GAL7_KLULA/191-363:0.19866,(((GAL7_HAEIN/179-348:0.06441,((GALT_LACHE/223-431:0.37440,GALT_STRMU/227-435:0.22883):0.26823,GALT_BACSU/236-451:0.10951):1.32821):0.10245,(GAL7_ECOLI/178-347:0.20695,GAL7_HUMAN/198-370:0.41876):0.10246):0.21820,GAL7_CRYNE/200-373:0.41081):0.13949,GAL7_YEAST/193-365:0.24864);
DTP  (GAL7_KLULA/191-363,(((GAL7_HAEIN/179-348,((GALT_LACHE/223-431,GALT_STRMU/227-435),GALT_BACSU/236-451)),(GAL7_ECOLI/178-347,GAL7_HUMAN/198-370)),GAL7_CRYNE/200-373),GAL7_YEAST/193-365);
DTL  4.42001
RID  0.355653
RPH  (((((GAL7_KLULA/191-363:0.14191,GAL7_YEAST/193-365:0.27300):0.14500,(GAL7_HUMAN/198-370:0.33112,(GAL7_ECOLI/178-347:0.22011,GAL7_HAEIN/179-348:0.12862):0.07271):0.23184):0.00000,GAL7_CRYNE/200-373:0.45219):2.66304,GALT_BACSU/236-451:0.05250):0.38415,GALT_STRMU/227-435:0.26878,GALT_LACHE/223-431:0.41268);
RTP  (((((GAL7_KLULA/191-363,GAL7_YEAST/193-365),(GAL7_HUMAN/198-370,(GAL7_ECOLI/178-347,GAL7_HAEIN/179-348))),GAL7_CRYNE/200-373),GALT_BACSU/236-451),GALT_STRMU/227-435,GALT_LACHE/223-431);
RTL  5.77764
LNK  GAL7_CRYNE/200-373:P40908:U16994
LNK  GAL7_ECOLI/178-347:P09148:X06226
LNK  GAL7_HAEIN/179-348:P31764:U32764
LNK  GAL7_HUMAN/198-370:P07902:M96264
LNK  GAL7_KLULA/191-363:P09580:CR382126
LNK  GAL7_STRLI/179-354:P13212:
LNK  GAL7_YEAST/193-365:P08431:X81324
LNK  GALT_BACSU/236-451:P39575:X73124
LNK  GALT_LACHE/223-431:Q00054:X57248
LNK  GALT_STRMU/227-435:P96994:AE014930
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  GAL7_YEAST/193-365
ASQ  EVSQE--------LKSFDKYKR--------EHNTDLFADYVKLESREKSRVVVENES------FIVVVPYWAIWPFETLVIS---KKKLASISQFNQMVKEDLASILKQLTIKY---DNLFETSFPYSMG------IHQAPLNATGDELS---NSWFHMHFY-PPLLRSATVRKFLV-GFELLGEPQRDLTSEQAAEKLRNLDG---------QIHYLQRL
DSQ  GAAGTTTCGCAAGAA------------------------TTGAAATCTTTTGATAAATATAAACGT------------------------GAACACAATACTGATTTGTTTGCCGATTACGTCAAATTAGAATCAAGAGAGAAGTCAAGAGTCGTAGTGGAGAATGAATCC------------------TTTATTGTTGTTGTTCCATACTGGGCCATCTGGCCATTTGAGACCTTGGTCATTTCA---------AAGAAGAAGCTTGCCTCAATTAGCCAATTTAACCAAATGGTGAAGGAGGACCTCGCCTCGATTTTAAAGCAACTAACTATTAAGTAT---------GATAATTTATTTGAAACGAGTTTCCCATACTCAATGGGT------------------ATCCATCAGGCTCCTTTGAATGCGACTGGTGATGAATTGAGT---------AATAGTTGGTTTCACATGCATTTCTAC---CCACCTTTACTGAGATCAGCTACTGTTCGGAAATTCTTGGTT---GGTTTTGAATTGTTAGGTGAGCCTCAAAGAGATTTAACTTCGGAACAAGCTGCTGAAAAACTAAGAAATTTAGATGGT---------------------------CAGATTCATTATCTACAAAGACTG
TRN  10010101100011000
NAM  GAL7_KLULA/191-363
ASQ  EPAKE--------FDHFEKYEH--------QHGAHLLEDYVNLELREKERIVCENDS------FLVVVPYWAVWPFETMVLS---KRRIPSLNQFTDKEREDLASIIRNLTIRY---DNLFETSFPYSMG------LHQASLNATEGELK---AAWFHMHFY-PPLLRSATVRKFLV-GFELLGQPQRDLTAEQAADRLKALSG---------EVHYLAKL
DSQ  GAACCTGCAAAAGAG------------------------TTTGACCACTTCGAGAAATATGAACAT------------------------CAACATGGTGCTCACTTGTTGGAAGATTATGTCAATTTAGAACTTCGCGAAAAGGAAAGAATTGTGTGCGAAAATGATTCT------------------TTCTTGGTTGTTGTTCCATATTGGGCCGTTTGGCCATTCGAAACCATGGTCCTCTCA---------AAACGTCGCATCCCATCCTTGAATCAATTTACTGATAAAGAAAGGGAAGATTTAGCATCTATCATCAGAAACTTGACCATCAGATAT---------GACAATCTCTTCGAAACGAGTTTCCCATACTCCATGGGT------------------CTTCACCAAGCCTCTCTCAACGCTACCGAAGGAGAATTGAAA---------GCCGCTTGGTTCCATATGCATTTCTAT---CCACCATTGCTAAGATCGGCCACTGTGAGAAAGTTCTTAGTA---GGGTTCGAGTTATTAGGACAACCACAAAGAGATTTGACTGCTGAACAAGCAGCAGATAGACTCAAAGCCCTAAGTGGT---------------------------GAAGTACATTATTTAGCAAAACTT
TRN  10010101110011000
NAM  GAL7_HAEIN/179-348
ASQ  EVARE--------DRTQRDYLL--------KHGSVMLVDYVKRELALKERIVVETEH------WIALVPYWAIWPFETLLLP---KTHVKRLTELSDEQSKDLAVILKKLTTKY---DNLFETSFPYSMG------FHAAPFNGEDNE-----HWQLHAHFY-PPLLRSATVRKFMV-GYEMLGENQRDLTAEQAAERLRALS----------EVHYKERT
DSQ  GAAGTTGCTCGTGAA------------------------GATCGTACACAACGTGATTATTTGCTA------------------------AAACATGGCTCAGTAATGTTGGTTGATTATGTAAAACGAGAATTGGCGTTGAAAGAACGTATTGTCGTTGAAACTGAACAT------------------TGGATCGCTTTAGTGCCTTATTGGGCTATTTGGCCATTTGAAACATTGCTTTTACCA---------AAAACTCATGTAAAACGTTTAACTGAATTAAGTGACGAACAATCAAAAGATCTTGCGGTTATTTTGAAAAAATTGACGACTAAATAC---------GACAATCTCTTTGAAACCTCTTTCCCATATTCAATGGGA------------------TTTCATGCGGCACCGTTTAATGGAGAAGATAACGAA---------------CATTGGCAGCTACATGCTCATTTTTAC---CCTCCTCTTTTGCGTTCAGCAACCGTGCGTAAATTTATGGTG---GGATATGAAATGTTAGGCGAAAACCAACGTGATTTAACGGCAGAACAGGCAGCAGAGCGATTACGTGCTTTGAGT------------------------------GAAGTTCATTATAAAGAAAGAACT
TRN  10010101110011000
NAM  GAL7_ECOLI/178-347
ASQ  EAERE--------DRLQKEYFA--------EQKSPMLVDYVQRELADGSRTVVETEH------WLAVVPYWAAWPFETLLLP---KAHVLRITDLTDAQRSDLALALKKLTSRY---DNLFQCSFPYSMG------WHGAPFNGEENQ-----HWQLHAHFY-PPLLRSATVRKFMV-GYEMLAETQRDLTAEQAAERLRAVS----------DIHFRESG
DSQ  GAAGCTGAGCGCGAA------------------------GACCGCCTGCAAAAAGAATATTTTGCC------------------------GAACAGAAATCACCAATGCTGGTGGATTATGTTCAGCGCGAGCTGGCAGACGGTAGCCGTACCGTTGTCGAAACCGAACAC------------------TGGTTAGCCGTCGTGCCTTACTGGGCTGCCTGGCCGTTCGAAACGCTACTGCTGCCC---------AAAGCCCACGTTTTACGGATCACCGATTTGACCGACGCCCAGCGCAGCGATCTGGCGCTGGCGTTGAAAAAGCTGACCAGTCGTTAT---------GACAACCTCTTCCAGTGCTCCTTCCCCTACTCTATGGGC------------------TGGCACGGCGCGCCATTTAATGGCGAAGAGAATCAA---------------CACTGGCAGCTGCACGCGCACTTTTAT---CCGCCTCTGCTGCGCTCCGCCACCGTACGTAAATTTATGGTT---GGTTATGAAATGCTGGCAGAGACCCAGCGAGACCTGACCGCAGAACAGGCAGCAGAGCGTTTGCGCGCAGTCAGC------------------------------GACATCCATTTTCGCGAATCCGGA
TRN  11011101101011000
NAM  GAL7_HUMAN/198-370
ASQ  IAQRE--------ERSQQAYKS--------QHGEPLLMEYSRQELLRKERLVLTSEH------WLVLVPFWATWPYQTLLLP---RRHVRRLPELTPAERDDLASIMKKLLTKY---DNLFETSFPYSMG------WHGAPTGSEAGANWN--HWQLHAHYY-PPLLRSATVRKFMV-GYEMLAQAQRDLTPEQAAERLRALP----------EVHYHLGQ
DSQ  ATTGCCCAGCGTGAG------------------------GAGCGATCTCAGCAGGCCTATAAGAGT------------------------CAGCATGGAGAGCCCCTGCTAATGGAGTACAGCCGCCAGGAGCTACTCAGGAAGGAACGTCTGGTCCTAACCAGTGAGCAC------------------TGGTTAGTACTGGTCCCCTTCTGGGCAACATGGCCCTACCAGACACTGCTGCTGCCC---------CGTCGGCATGTGCGGCGGCTACCTGAGCTGACCCCTGCTGAGCGTGATGATCTAGCCTCCATCATGAAGAAGCTCTTGACCAAGTAT---------GACAACCTCTTTGAGACGTCCTTTCCCTACTCCATGGGC------------------TGGCATGGGGCTCCCACAGGATCAGAGGCTGGGGCCAACTGGAAC------CATTGGCAGCTGCACGCTCATTACTAC---CCTCCGCTCCTGCGCTCTGCCACTGTCCGGAAATTCATGGTT---GGCTACGAAATGCTTGCTCAGGCTCAGAGGGACCTCACCCCTGAGCAGGCTGCAGAGAGACTAAGGGCACTTCCT------------------------------GAGGTTCATTACCACCTGGGGCAG
TRN  10010101100011000
NAM  GAL7_CRYNE/200-373
ASQ  EPATE--------IENFVRYASG-------RSGSHMLLDYALREVKARERVVTLHESG-----WVAVVPYWAAWPFEILLMPY--KRHIPSILQLTAEEQTGLATILKDVLSRY---DNLFSCPFPYSMG------LHQSPLPPTDPTSN---SAQVHFHFY-PPLLRSATVRKFMV-GFELLGEAQRDIVPEQAAVRLRESL-----------PHKRATL
DSQ  GAACCCGCTACCGAA------------------------ATCGAGAACTTTGTTCGCTATGCCTCAGGT---------------------CGTTCCGGGTCTCATATGCTGTTGGACTATGCTCTTCGCGAAGTAAAGGCTAGAGAGAGAGTCGTAACGTTGCACGAAAGCGGC---------------TGGGTCGCAGTAGTGCCATACTGGGCTGCGTGGCCATTTGAAATCCTGCTCATGCCTTAC------AAACGCCATATCCCATCGATCTTACAACTGACAGCGGAGGAACAAACTGGATTAGCGACGATCTTGAAAGATGTACTGAGTCGCTAT---------GACAATCTGTTCTCATGTCCTTTCCCTTATTCCATGGGT------------------TTGCACCAGTCTCCTCTGCCTCCGACAGACCCGACATCAAAC---------TCCGCCCAAGTTCATTTCCATTTCTAC---CCACCTCTCCTCCGAAGCGCAACAGTGAGAAAGTTCATGGTC---GGATTCGAGCTCTTAGGGGAGGCGCAGCGAGATATTGTACCGGAACAAGCGGCTGTTCGTCTGCGAGAGTCCCTT---------------------------------CCTCATAAACGTGCAACACTT
TRN  10010101100011000
NAM  GAL7_STRLI/179-354
ASQ  RTALM--------LRSLAAHKD--------ATGGGNLFDSVLEEELAGERVVLEGEH------WAAFVAYGAHWPYEVHLYP---KRRVPDLLGLDEAARTEFPKVYLELLRRFDRIFGEGEPPTPYIAA------WHQAPFGQLEFEGVTRDDFALHLNFSLPPYVRQAEVPRGLR--IRHERVHQRDVPPERAAERLREVA----------DVHERE--
NAM  GALT_LACHE/223-431
ASQ  VINQQTLINLVEIEKIFPHYFVGSNADLPIVGGSMLAHEHYQGGRHTFPMMKAGIKKNIMFDSYPKVVAGIVDWPMSDLRLTSDNSLDLIDLGSKIIKFWDNYSDTARDIKAYEG--ETRHHTVTPIMHREGKNFVLDLVLRDNNTSEKYP--LGIFHPHKQ-LWHIKKENIGLIEVMGRAILPGRLKSELEEVKKYWLGED-------NKMAASHKEWAD
DSQ  GTGATTAATCAACAGACCTTGATTAACTTGGTTGAAATTGAAAAAATCTTCCCTCATTACTTCGTTGGTTCTAATGCTGATTTACCAATTGTTGGTGGTTCAATGCTTGCTCATGAACACTATCAAGGTGGTCGTCATACTTTCCCAATGATGAAGGCTGGAATCAAGAAGAATATTATGTTTGATTCTTATCCTAAAGTTGTGGCAGGCATCGTTGATTGGCCAATGAGTGATTTACGTTTAACTTCAGATAATTCACTTGATTTGATTGATCTTGGCAGCAAGATTATTAAATTCTGGGATAACTATTCTGATACTGCGCGTGATATTAAGGCTTATGAAGGC------GAGACACGTCACCATACTGTCACTCCAATCATGCACCGTGAAGGTAAGAATTTTGTCCTTGATCTTGTTTTACGTGATAACAATACTAGCGAGAAATACCCA------CTTGGAATTTTCCACCCACACAAACAA---TTGTGGCACATTAAGAAGGAAAATATCGGCTTGATTGAAGTTATGGGTAGAGCTATTTTGCCAGGACGACTTAAGAGTGAACTTGAAGAAGTAAAGAAATACTGGCTTGGTGAAGAC---------------------AATAAGATGGCTGCAAGTCATAAAGAATGGGCTGAT
TRN  10010101110011000
NAM  GALT_STRMU/227-435
ASQ  VISQNTFRQLLDIVDIFPGYFAGSNSDLPIVGGSILSHNHYQGGRHIFPMEIAELDSVFRFKDFPDVTAGIVKWPMSVIRLRGANKYSLVELAEIIRLAWRNYSDDTMNILAFTG--DTPHHTVTPIARKRDGQFELDIVLRDNHTTAEYP--DGVYHPHID-VQHIKKENIGLIEVMGLAILPPRLKKELAEVEKYVLNQY-------NEMADYHKDWAD
DSQ  GTGATTAGCCAGAACACTTTTAGACAGCTCCTTGACATTGTAGACATCTTCCCGGGTTATTTTGCGGGTTCTAACTCAGATTTGCCTATTGTCGGTGGCTCTATCTTAAGTCACAATCATTATCAAGGCGGCCGTCACATTTTTCCTATGGAAATAGCAGAGTTGGATAGCGTGTTTCGTTTCAAAGACTTTCCAGATGTGACAGCAGGTATTGTCAAGTGGCCTATGTCAGTTATCAGACTGCGTGGAGCAAACAAGTATAGCTTGGTGGAATTGGCTGAAATCATTCGTCTGGCTTGGCGTAACTATTCTGATGATACGATGAACATTCTTGCATTTACAGGT------GATACACCGCATCACACTGTGACACCGATTGCTCGAAAACGCGATGGACAATTTGAGCTGGATATTGTTTTACGTGACAATCATACGACAGCAGAGTATCCT------GACGGAGTTTATCATCCTCATATTGAT---GTGCAGCATATTAAGAAAGAAAATATCGGGCTGATTGAGGTTATGGGCTTAGCCATTTTACCGCCAAGACTGAAAAAAGAGCTGGCAGAAGTTGAAAAATACGTGTTAAACCAGTAT---------------------AATGAAATGGCCGATTACCACAAAGACTGGGCTGAT
TRN  10010101100011000
NAM  GALT_BACSU/236-451
ASQ  EISKKTFERLLSFLGQYPHYFIGSNADLPIVGGTILSHDHFQGGAHDFPMARAEAEDVYELNDYPGVSLGLVKWPMSVLRLQGDEPGHVAEAADHIFRTWQTYSDEKAGIAAYTG--DTPHNTVTPIARRRGDLYELDIVLRNNRTDEEHP--LGIFHPHQE-VHHIKKENIGLIEVMGLAILPGRLQEEMKETAAALCSADPKTALEQNPLTAKHSEWAL
DSQ  GAGATCAGCAAAAAAACATTTGAAAGGCTGCTGTCATTTCTTGGCCAATATCCGCATTATTTTATCGGTTCAAACGCGGATCTGCCGATTGTCGGCGGCACGATCCTAAGCCATGATCATTTCCAAGGCGGCGCGCATGATTTTCCAATGGCACGTGCAGAAGCGGAAGACGTTTATGAATTAAATGATTATCCCGGCGTGTCGCTGGGCTTAGTGAAGTGGCCGATGTCTGTGCTCAGGCTCCAAGGAGACGAACCGGGTCATGTCGCCGAAGCTGCTGACCATATCTTCCGCACGTGGCAGACGTATTCCGATGAAAAAGCCGGCATTGCCGCCTATACAGGC------GATACGCCCCATAATACGGTCACACCGATTGCGCGGCGCAGGGGAGACTTGTACGAACTCGATATCGTACTGAGGAACAACCGGACGGATGAGGAGCATCCA------TTAGGAATATTTCATCCTCATCAAGAA---GTCCACCATATTAAAAAAGAAAATATCGGCCTGATTGAGGTCATGGGATTGGCGATATTGCCTGGCCGCTTACAGGAGGAAATGAAAGAAACGGCAGCGGCGCTATGTTCTGCTGATCCGAAAACAGCCTTAGAACAAAATCCGCTCACTGCAAAGCATAGTGAGTGGGCTCTT
TRN  10010101100011000
//