EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02742 - Fe_dep_repr_C)
FAM  PF02742
PID  Fe_dep_repr_C
DES  Iron dependent repressor, metal binding and dimerisation domain
IPR  IPR001367
ANO  10
ALN  73
AID  0.295599
APH  ((((((O30276_ARCFU/63-134:1.03802,MNTR_BACSU/63-133:0.92914):0.23190,O28489_ARCFU/62-132:1.34107):0.35038,O26316_METTH/68-138:0.21263):0.42680,O27019_METTH/72-140:0.65751):0.12574,(O28295_ARCFU/70-137:1.29910,(O33330_MYCTU/72-142:0.28674,P72424_STAEP/63-133:0.57489):0.18473):0.36680):0.28055,DTXR_CORDI/65-135:0.20786,Q50379_MYCSM/65-135:0.11836);
ATP  ((((((O30276_ARCFU/63-134,MNTR_BACSU/63-133),O28489_ARCFU/62-132),O26316_METTH/68-138),O27019_METTH/72-140),(O28295_ARCFU/70-137,(O33330_MYCTU/72-142,P72424_STAEP/63-133))),DTXR_CORDI/65-135,Q50379_MYCSM/65-135);
ATL  8.63221
DNO  10
DLN  219
DID  0.407136
DPH  ((O28489_ARCFU/62-132:0.71210,(O26316_METTH/68-138:0.27448,(((O28295_ARCFU/70-137:0.63362,(O33330_MYCTU/72-142:0.30389,P72424_STAEP/63-133:0.59634):0.16417):0.11687,(Q50379_MYCSM/65-135:0.14869,DTXR_CORDI/65-135:0.31078):0.20648):0.22416,O27019_METTH/72-140:0.36389):0.12022):0.32400):0.10230,O30276_ARCFU/63-134:0.53133,MNTR_BACSU/63-133:0.69025);
DTP  ((O28489_ARCFU/62-132,(O26316_METTH/68-138,(((O28295_ARCFU/70-137,(O33330_MYCTU/72-142,P72424_STAEP/63-133)),(Q50379_MYCSM/65-135,DTXR_CORDI/65-135)),O27019_METTH/72-140))),O30276_ARCFU/63-134,MNTR_BACSU/63-133);
DTL  5.82357
RID  0.295599
RPH  ((((((O30276_ARCFU/63-134:1.03802,MNTR_BACSU/63-133:0.92914):0.23190,O28489_ARCFU/62-132:1.34107):0.35038,O26316_METTH/68-138:0.21263):0.42680,O27019_METTH/72-140:0.65751):0.12574,(O28295_ARCFU/70-137:1.29910,(O33330_MYCTU/72-142:0.28674,P72424_STAEP/63-133:0.57489):0.18473):0.36680):0.28055,DTXR_CORDI/65-135:0.20786,Q50379_MYCSM/65-135:0.11836);
RTP  ((((((O30276_ARCFU/63-134,MNTR_BACSU/63-133),O28489_ARCFU/62-132),O26316_METTH/68-138),O27019_METTH/72-140),(O28295_ARCFU/70-137,(O33330_MYCTU/72-142,P72424_STAEP/63-133))),DTXR_CORDI/65-135,Q50379_MYCSM/65-135);
RTL  8.63221
LNK  DTXR_CORDI/65-135:P33120:M80336
LNK  MNTR_BACSU/63-133:P54512:D84432
LNK  O26316_METTH/68-138:O26316:AE000808
LNK  O27019_METTH/72-140:O27019:AE000868
LNK  O28295_ARCFU/70-137:O28295:AE000966
LNK  O28489_ARCFU/62-132:O28489:AE000979
LNK  O30276_ARCFU/63-134:O30276:AE001111
LNK  O33330_MYCTU/72-142:O33330:BX842580
LNK  P72424_STAEP/63-133:P72424:X99128
LNK  Q50379_MYCSM/65-135:Q50379:U14190
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  MNTR_BACSU/63-133
ASQ  TSKGKKIGKRLVYRHELLDQFLR-IIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKD-LKSI
DSQ  ACGTCTAAAGGGAAAAAAATAGGCAAACGGCTGGTATACAGACATGAATTGCTTGACCAGTTTTTAAGA---ATCATTGGTGTTGATGAAGAGAAAATATATAACGATGTCGAAGGAATCGAACATCATTTAAGCTGGAACAGTATTGATCGCATCGGGGATCTTGTTCAATATTTTGAAGAAGATGATGCCCGTAAAAAAGAT---CTGAAATCAATC
TRN  10010101100011000
NAM  O30276_ARCFU/63-134
ASQ  TEKGVREAMKLREKRNVVIKFLK-AIGVPEDVAERDACTIEHVLHPETLRQLRNFVRFVESSPAVNPRWLEHF
DSQ  ACGGAAAAAGGTGTCAGGGAAGCGATGAAGCTGAGGGAGAAAAGAAATGTTGTAATCAAGTTCCTCAAG---GCGATAGGGGTTCCAGAAGATGTGGCCGAAAGGGATGCGTGCACCATTGAGCACGTCCTGCATCCCGAAACTCTCAGGCAGCTCAGAAACTTTGTTAGATTTGTTGAATCCAGCCCGGCTGTAAATCCGAGATGGTTGGAGCATTTT
TRN  10010101100011011
NAM  Q50379_MYCSM/65-135
ASQ  TDKGRALAVAVMRKHRLAERLLVDVIGLPWEDVHAEACRWEHVMSEEVERRLVQVLENPTTSPFGNP--IPGL
DSQ  ACCGACAAGGGCCGCGCTCTCGCGGTGGCCGTGATGCGTAAGCACCGGCTCGCCGAGCGGCTTCTGGTCGACGTGATCGGCCTGCCGTGGGAGGACGTCCACGCCGAGGCGTGCCGCTGGGAGCACGTCATGAGCGAGGAGGTCGAGCGCCGGCTGGTCCAGGTGCTCGAGAACCCCACCACCTCCCCGTTCGGGAACCCC------ATCCCCGGGCTG
TRN  11011111101111111
NAM  DTXR_CORDI/65-135
ASQ  TPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNP--IPGL
DSQ  ACGCCAACAGGTCGTACGTTAGCGACTGCAGTCATGCGTAAGCATCGCTTAGCAGAGCGCCTTCTTACCGATATCATTGGCCTAGATATCAATAAAGTTCACGATGAAGCCTGCCGATGGGAACATGTCATGAGCGACGAAGTTGAGCGCAGGCTCGTGAAAGTGCTGAAAGATGTCAGCAGGTCCCCCTTCGGAAACCCG------ATTCCAGGGCTT
TRN  10010101100011010
NAM  O26316_METTH/68-138
ASQ  TDRGYRIARRITRKHRLLERFLHDVLGIKRERIHRQACEMEHSLSDDAERALCHLLNMPGECPDEKP--IPAC
DSQ  ACAGATAGAGGATACAGGATCGCCCGTAGAATAACAAGGAAGCACAGGCTCCTTGAGAGATTCCTCCATGACGTTCTGGGAATAAAGAGGGAGAGGATACACCGGCAGGCCTGTGAAATGGAACATTCACTCTCAGACGATGCTGAAAGGGCCCTGTGCCATCTCCTTAACATGCCAGGAGAGTGCCCCGATGAAAAGCCC------ATACCCGCATGT
TRN  10010101100011001
NAM  P72424_STAEP/63-133
ASQ  TEEGLKQTLDIIKRHRLLELFLIEILQYNWEEVHQEAEILEHRISDLFVERLDKILNFPKTCPHGGV--IPRG
DSQ  ACTGAAGAAGGGTTAAAGCAAACGTTAGACATCATAAAACGACATCGATTACTAGAATTATTTTTAATAGAAATTTTACAATATAATTGGGAAGAGGTTCATCAAGAAGCTGAAATACTTGAACATCGGATATCAGATTTATTTGTAGAACGTTTAGATAAGATTTTAAATTTTCCGAAAACATGCCCTCATGGAGGCGTC------ATTCCTAGAGGT
TRN  10010101110011000
NAM  O33330_MYCTU/72-142
ASQ  TDSGRRAALAMVRRHRLLETFLVNELGYRWDEVHDEAEVLEHAVSDRLMARIDAKLGFPQRDPHGDP--IPGA
DSQ  ACCGATTCGGGGCGACGAGCCGCGCTGGCAATGGTGCGCCGGCACCGGCTACTGGAGACATTCCTGGTCAACGAGCTCGGCTACCGCTGGGACGAGGTGCACGACGAGGCCGAGGTGCTCGAGCACGCGGTCTCGGATCGCTTGATGGCCCGCATCGACGCCAAGCTGGGGTTCCCGCAGCGCGATCCGCACGGTGACCCG------ATCCCGGGCGCC
TRN  11011111101111111
NAM  O27019_METTH/72-140
ASQ  TDEGREIAEMVLRRHMILECFFHNVLGMDLDSSYEEASRMKHELFRETELALMRYLRNPARCPHGIP--IP--
DSQ  ACAGATGAGGGAAGGGAGATTGCAGAGATGGTTCTAAGGAGGCACATGATCCTGGAGTGCTTCTTCCACAACGTCCTTGGAATGGACCTCGACTCATCCTATGAGGAGGCCTCCCGCATGAAGCACGAGCTCTTCAGGGAAACAGAGCTGGCACTCATGAGGTACCTGAGGAACCCGGCAAGGTGCCCCCACGGCATACCC------ATACCC------
TRN  10010101100011001
NAM  O28295_ARCFU/70-137
ASQ  NERGKMEARAAVRMHRLIECLLA---DLGVEDFCKEAEKIGMVAGSSLVDALEARYGDREFCPCGKR--IPEV
DSQ  AATGAAAGGGGAAAAATGGAAGCAAGGGCAGCGGTAAGGATGCACAGGCTTATAGAGTGCCTTCTCGCA---------GACCTCGGCGTGGAGGACTTCTGCAAGGAGGCTGAAAAAATAGGCATGGTTGCCGGCAGCAGCCTCGTTGATGCCCTCGAAGCAAGGTACGGTGACAGAGAATTCTGCCCGTGTGGGAAGAGA------ATTCCGGAGGTG
TRN  10010101110011011
NAM  O28489_ARCFU/62-132
ASQ  TRKGEELARRIKKYYLALYHFFKDYLGIQDELAEKLSCELEHHITEDAFVRVCRIISGNCEVCESCT--QEYL
DSQ  ACAAGAAAGGGGGAAGAGCTTGCAAGGAGAATTAAGAAGTACTATCTCGCTCTCTACCACTTCTTTAAGGACTACCTCGGCATACAGGACGAGCTTGCAGAAAAGCTGAGCTGCGAATTGGAGCACCACATTACAGAAGATGCATTCGTCAGGGTGTGCAGAATAATTTCTGGAAATTGTGAGGTTTGCGAGAGCTGCACC------CAGGAGTACCTC
TRN  10010101100011011
//