EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02718 - Herpes_UL31)
FAM  PF02718
PID  Herpes_UL31
DES  Herpesvirus UL31-like protein
IPR  IPR003868
ANO  9
ALN  285
AID  0.332077
APH  (((((O36420_9GAMA/19-278:0.56499,Q66672_9GAMA/27-305:0.47751):0.09606,(O41970_MHV68/23-289:0.73101,(O40945_HHV8/27-302:0.34521,UL31_SHV21/1-259:0.38759):0.06661):0.10784):0.22046,UL31_EBV/52-316:0.59878):1.33503,UL53_HCMVA/29-287:0.32937):0.33838,UL31_HHV6U/14-263:0.30785,UL31_HHV7J/15-258:0.14541);
ATP  (((((O36420_9GAMA/19-278,Q66672_9GAMA/27-305),(O41970_MHV68/23-289,(O40945_HHV8/27-302,UL31_SHV21/1-259))),UL31_EBV/52-316),UL53_HCMVA/29-287),UL31_HHV6U/14-263,UL31_HHV7J/15-258);
ATL  6.0521
DNO  9
DLN  855
DID  0.438842
DPH  ((UL31_HHV7J/15-258:0.28207,UL31_HHV6U/14-263:0.19397):0.30768,(((O41970_MHV68/23-289:0.51348,((O36420_9GAMA/19-278:0.45181,UL31_SHV21/1-259:0.35515):0.13509,O40945_HHV8/27-302:0.31418):0.06258):0.08001,Q66672_9GAMA/27-305:0.29551):0.11461,UL31_EBV/52-316:0.42210):0.66566,UL53_HCMVA/29-287:0.23828);
DTP  ((UL31_HHV7J/15-258,UL31_HHV6U/14-263),(((O41970_MHV68/23-289,((O36420_9GAMA/19-278,UL31_SHV21/1-259),O40945_HHV8/27-302)),Q66672_9GAMA/27-305),UL31_EBV/52-316),UL53_HCMVA/29-287);
DTL  4.43218
RID  0.332077
RPH  (((((O36420_9GAMA/19-278:0.56499,Q66672_9GAMA/27-305:0.47751):0.09606,(O41970_MHV68/23-289:0.73101,(O40945_HHV8/27-302:0.34521,UL31_SHV21/1-259:0.38759):0.06661):0.10784):0.22046,UL31_EBV/52-316:0.59878):1.33503,UL53_HCMVA/29-287:0.32937):0.33838,UL31_HHV6U/14-263:0.30785,UL31_HHV7J/15-258:0.14541);
RTP  (((((O36420_9GAMA/19-278,Q66672_9GAMA/27-305),(O41970_MHV68/23-289,(O40945_HHV8/27-302,UL31_SHV21/1-259))),UL31_EBV/52-316),UL53_HCMVA/29-287),UL31_HHV6U/14-263,UL31_HHV7J/15-258);
RTL  6.0521
LNK  O36420_9GAMA/19-278:O36420:AF005370
LNK  O40945_HHV8/27-302:O40945:U93872
LNK  O41970_MHV68/23-289:O41970:U97553
LNK  Q66672_9GAMA/27-305:Q66672:U20824
LNK  UL31_EBV/52-316:P03183:M11923
LNK  UL31_HHV6U/14-263:P28865:X83413
LNK  UL31_HHV7J/15-258:P52361:U43400
LNK  UL31_SHV21/1-259:Q01041:X64346
LNK  UL53_HCMVA/29-287:P16794:X17403
AMK  xxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  UL53_HCMVA/29-287
ASQ  LASKvASTVNGATSANNHGEPPSPADARPRLTLHDLHDIFREHPELELKYLNMMKMAITGKESICLPFNFHSHRQHTCLDISPYGNEQVSRIACTSCED-----------------------NRILPTASDAMVAFINQTSNIMKNRNFYYGFCK-SSELLKLSTNQPPIFQIYYLLHAANHDIVPFMHAE-DGRLHMHVIFENPDVHIPCDCITQMLTAAREDYSVTLNIVRDHVVISVLCHAVSA-SSVKIDVTILQRKIDEMDIPNDVSESFERYKELIQEL
DSQ  CTGGCCAGCAAAgtgGCGTCGACGGTGAACGGCGCTACGTCGGCCAACAACCACGGCGAACCGCCGTCGCCGGCCGACGCGCGCCCGCGCCTCACGCTGCACGACCTGCACGACATCTTCCGCGAGCACCCCGAACTGGAGCTCAAGTACCTTAACATGATGAAGATGGCCATCACGGGCAAAGAGTCCATCTGCTTACCCTTCAATTTCCACTCGCACCGGCAGCACACCTGCCTCGACATCTCGCCGTACGGCAACGAGCAGGTCTCGCGCATCGCCTGCACCTCGTGCGAGGAC---------------------------------------------------------------------AACCGCATCCTGCCCACCGCCTCCGACGCCATGGTGGCCTTCATCAATCAGACGTCCAACATCATGAAAAATAGAAACTTTTATTACGGGTTCTGTAAG---AGCAGCGAGCTACTCAAGCTCTCCACCAACCAGCCGCCCATCTTCCAAATTTATTACCTGCTGCACGCCGCCAACCACGACATCGTGCCCTTTATGCACGCCGAG---GACGGCCGGTTGCACATGCACGTCATCTTCGAAAACCCCGACGTGCACATCCCCTGCGACTGCATCACGCAGATGCTCACGGCGGCGCGCGAAGACTACAGCGTCACGCTCAACATCGTGCGCGACCACGTCGTTATCAGCGTGCTGTGTCACGCCGTCTCGGCC---AGCAGCGTCAAGATCGACGTGACTATTTTGCAACGCAAGATTGACGAGATGGACATTCCCAACGACGTGAGCGAGTCCTTTGAGCGCTACAAAGAGCTCATTCAGGAGCTG
TRN  10010101100011010
NAM  UL31_HHV7J/15-258
ASQ  LLK-.-------KSKPYNKEK---TNLSLSLSLKELHSVFKLFPEYELKFLNMMKLPITGKEPIKIPFDLSLHHQHTCLDLSPYANEQVSKSACVNCG------------------------TTNIPTASDAMVAYMNQISNVMQNRLYYYGFQK-KVELIRMSAKQPTLFQIFYILSSIASNFLPIMFEN-NEKLNMYVVFQTRTLHIPCECINQIMTVS-SGYTVLLDILHDSIVLHVLCKTIET-SNIQIDINVLQRKIEEMDVPDEIGDKFEKLK-HILPF
DSQ  TTGTTAAAG---...---------------------AAAAGCAAACCTTACAACAAAGAAAAA---------ACTAACTTATCTTTATCTTTGTCACTTAAAGAACTCCATTCGGTTTTCAAATTATTTCCAGAGTATGAATTGAAATTTCTAAATATGATGAAACTTCCAATAACCGGTAAAGAACCTATCAAAATTCCATTCGATCTAAGTCTACATCATCAACATACGTGCTTAGACTTATCACCATATGCCAATGAACAAGTTTCAAAAAGTGCATGTGTTAATTGTGGT------------------------------------------------------------------------ACAACAAACATTCCAACAGCTTCAGATGCTATGGTGGCATATATGAATCAAATTTCAAACGTAATGCAAAATAGATTATATTACTACGGTTTTCAGAAA---AAGGTTGAACTGATTCGTATGTCAGCCAAGCAACCAACGCTTTTTCAAATTTTTTATATTCTTTCAAGCATAGCAAGTAATTTTTTACCAATCATGTTTGAAAAT---AACGAGAAATTAAATATGTATGTTGTTTTCCAAACAAGAACTCTTCATATTCCTTGCGAATGTATCAATCAGATTATGACAGTCTCT---TCCGGATACACTGTACTTTTAGACATCTTACACGACAGCATTGTACTACATGTTCTTTGTAAAACTATTGAGACT---AGCAATATTCAAATTGATATTAATGTTCTTCAGCGAAAAATTGAGGAAATGGACGTACCCGATGAAATAGGTGACAAGTTCGAAAAGCTGAAA---CACATTCTACCGTTT
TRN  10010101100011000
NAM  UL31_HHV6U/14-263
ASQ  LSVThR-----IQKRPDHREK---TKLYLQLKLHDLHTVFNLFPEYEQKFLAIIKLPITGKEPIDVPFSLSNHHQHTCLEFSPYANEQISKSACLHCE------------------------SVSVPTSSDAMVAHLNQVNNVMQNRLYFYGFRK-DMELIRMSAKQPTIFQIFYIVHNTINNIFPIMFER-KQKLGMHIVFQSRTLHIPCECIKQIVAVS-SGYNVYLDILQESVILTVLCETLDTNTNIHIDIGMLQKKLEEMDIPNEISDRLEKYKGHLIGF
DSQ  CTGTCCGTGACAcacAGA---------------ATACAAAAACGACCTGATCACAGAGAAAAA---------ACAAAGCTTTACTTACAACTGAAACTTCACGATCTACACACCGTCTTCAACCTGTTTCCAGAATACGAACAGAAATTTCTAGCGATCATAAAACTGCCAATTACCGGTAAAGAACCCATCGACGTCCCATTCAGTCTCAGCAATCACCACCAACACACCTGCCTAGAATTCTCCCCCTACGCTAACGAACAAATCTCCAAAAGCGCCTGCCTACACTGCGAA------------------------------------------------------------------------TCCGTCTCCGTTCCAACCTCCTCAGATGCAATGGTCGCCCACTTGAACCAAGTCAACAACGTCATGCAAAACAGACTTTACTTCTACGGTTTTCGAAAG---GACATGGAGCTCATACGAATGTCCGCCAAACAACCCACTATCTTTCAAATCTTTTATATTGTCCACAACACGATCAACAACATATTCCCTATCATGTTCGAAAGA---AAACAAAAGCTCGGAATGCACATAGTTTTCCAGTCTCGCACTCTGCACATTCCTTGTGAATGCATTAAACAAATAGTAGCGGTATCC---TCGGGCTACAACGTTTATCTAGATATACTACAAGAAAGTGTAATCCTAACTGTCCTCTGCGAAACACTAGATACCAATACTAATATCCACATCGACATAGGGATGCTTCAAAAAAAACTCGAAGAAATGGACATCCCAAACGAAATAAGCGACAGACTCGAAAAATACAAAGGACACCTAATAGGTTTC
TRN  10010101100011000
NAM  UL31_SHV21/1-259
ASQ  MSS-.-RSVK---SRKSTKSRRHHPYVK--LTDKMFFSAISSKKELGTDFLREMDAPICTSKTILLPLDLNSISPGRCIYLSPFGHSSNMEFQCEKCTESKN----KGS------GD-----VSQNHDLYSVTLVFYKNVDKVVKHKAFYLSLLSHSMENLKKSFTQPELLYAYVVVKEAGHNVFPIFFEK-DDCLSICLTFKCQTLHIGESCLRMLMDNL-PNYKISIDYIKDVYAMTFTQCFAIQ-RNISIAEDTICESVSTLDCTDELREEIVKGINALQIK
DSQ  ATGTCATCA---...---AGATCTGTAAAA---------TCTAGAAAAAGCACAAAGAGCCGCAGACATCACCCATACGTCAAA------CTCACAGACAAAATGTTTTTCTCAGCAATATCATCAAAGAAAGAACTTGGAACAGACTTTTTAAGAGAAATGGATGCACCGATATGCACTTCAAAAACTATTCTCCTTCCTCTAGACTTAAACAGCATTTCACCAGGAAGATGCATATATTTATCTCCTTTTGGACACTCTTCTAACATGGAGTTTCAGTGTGAAAAATGCACTGAAAGCAAAAAT------------AAAGGCAGT------------------GGTGAC---------------GTGAGTCAAAATCATGACTTGTATTCAGTTACTTTAGTTTTTTATAAAAATGTAGACAAAGTAGTGAAACATAAAGCTTTCTATTTGTCTCTGCTTAGCCACTCTATGGAAAATTTAAAGAAAAGCTTTACTCAGCCAGAGCTCTTATACGCATATGTTGTAGTAAAAGAAGCTGGACACAACGTATTTCCAATTTTTTTTGAAAAA---GATGATTGCCTCAGTATTTGTCTGACATTTAAGTGCCAGACGTTGCACATTGGCGAATCTTGCTTAAGAATGCTTATGGACAATTTA---CCAAACTATAAAATTTCAATTGATTACATCAAAGATGTTTATGCAATGACATTTACTCAGTGTTTTGCAATACAG---AGAAACATCTCTATCGCAGAAGACACGATATGTGAATCTGTGTCTACTCTTGATTGTACTGATGAGCTCAGAGAAGAAATTGTAAAAGGCATAAATGCTCTTCAAATAAAA
TRN  10010101100011000
NAM  O40945_HHV8/27-302
ASQ  LSSR.LRSVPPG-ARSASVSSKHRNGLRKFISDKVFFSILSHRHELGVDFLREMETPICTSKTVMLPLDLSTVAPGRCVSLSPFGHSSNMGFQCALCPSTENPTVAQGSRPQTMVGDA----LKKNNELCSVALAFYHHADKVIQHKTFYLSLLSHSMDVVRQSFLQPGLLYANLVLKTFGHDPLPIFTTN-NGMLTMCILFKTRALHLGETALRLLMDNL-PNYKISADCCRQSYVVKFVPTHPDT-ASIAVQVHTICEAVAALDCTDEMRDDIQKGTALVNAL
DSQ  TTGTCATCCCGC...CTGCGGTCGGTCCCGCCCGGG---GCGCGAAGCGCCAGCGTCAGCAGCAAGCACAGAAACGGCCTTCGCAAGTTTATCTCAGACAAGGTATTTTTTAGCATCCTATCGCACAGACACGAGCTAGGAGTGGACTTTCTCCGTGAGATGGAGACCCCGATATGCACCTCCAAAACAGTAATGCTGCCCCTAGACCTGTCTACCGTCGCACCCGGCCGCTGCGTCTCCCTCTCTCCGTTTGGACACTCCTCAAACATGGGGTTCCAGTGCGCTCTGTGCCCATCCACAGAAAATCCCACCGTTGCCCAAGGCTCCCGGCCTCAGACAATGGTGGGCGATGCG------------CTCAAAAAAAATAACGAGCTATGCTCGGTAGCGCTGGCCTTTTATCACCACGCAGACAAAGTGATCCAACACAAGACGTTTTACCTATCACTCCTCAGTCACTCCATGGATGTGGTTCGGCAGAGCTTCCTGCAGCCTGGTCTACTGTACGCTAACCTGGTCCTAAAAACCTTTGGGCACGATCCCCTACCCATCTTCACTACCAAC---AACGGCATGCTAACAATGTGCATCCTTTTTAAAACCCGGGCACTACATCTGGGAGAAACTGCGCTTAGGCTGCTTATGGATAACCTC---CCCAACTACAAGATATCGGCGGACTGCTGCAGACAGTCCTACGTGGTCAAGTTTGTCCCAACGCACCCGGACACC---GCAAGCATTGCAGTGCAGGTACACACCATATGCGAAGCGGTTGCGGCGCTAGACTGCACCGACGAGATGCGGGATGACATTCAAAAGGGAACCGCACTTGTCAACGCCCTA
TRN  10010101100011001
NAM  Q66672_9GAMA/27-305
ASQ  RKSLaLRSLNKFHPYKAPSSVRSLKKAHTLVSNGDFFNGISLNCEFGKDFLREMDTPICTSKVICLPLDVHEIAPGRCLVLSPLGHACNMGFYCEKCTQSGQ---NSYSQFQGRGGNAKMAAQNSKDDLHSVTLTFYNQVSKVVQNKNFYLSLLSHSLTTIKKSFVQPSLLYSYTVLRALCDDVFPIFKDT-ENGLCMFALFKTDDLHVSETCLRHLVDNL-IHYRVTLDCVKHTYMLKFSPIRAEA-NGMTIQEVEICEAITGLDFTDEIKQEIISGQELVSEL
DSQ  CGCAAGAGCCTGgccCTGAGGTCCCTGAACAAGTTCCACCCCTACAAGGCCCCCTCCTCGGTGAGGAGCCTCAAGAAGGCCCACACCCTGGTGTCCAACGGGGACTTCTTTAACGGCATCTCCCTCAACTGTGAGTTTGGGAAGGACTTCCTGAGGGAGATGGACACCCCCATATGCACCTCTAAGGTCATCTGCCTGCCCCTGGACGTCCACGAGATCGCCCCGGGCAGGTGCCTGGTGCTGTCCCCTCTGGGGCACGCTTGCAACATGGGCTTCTACTGCGAGAAGTGCACCCAGTCCGGTCAG---------AACTCCTACTCCCAGTTTCAGGGGAGGGGGGGCAACGCCAAGATGGCGGCCCAGAACTCCAAGGACGACCTCCACTCGGTCACCCTGACTTTTTACAATCAGGTCAGCAAGGTGGTGCAGAATAAGAACTTTTATCTGTCCCTCCTCAGCCACTCCCTGACCACCATCAAGAAGAGCTTCGTGCAGCCCAGCCTGCTGTACAGCTACACGGTGCTGAGGGCCCTCTGCGATGACGTGTTCCCCATTTTCAAGGACACC---GAGAACGGCCTCTGCATGTTCGCCCTCTTTAAGACGGACGACCTGCACGTCAGCGAGACGTGCCTGAGGCACCTGGTAGACAACCTC---ATCCACTACAGGGTCACCCTGGACTGCGTCAAGCATACCTACATGCTCAAGTTCTCACCGATCCGCGCGGAAGCT---AACGGAATGACTATTCAGGAGGTGGAGATCTGCGAGGCCATTACGGGGCTGGATTTCACTGATGAGATAAAACAAGAGATCATTAGCGGGCAGGAACTGGTTTCAGAACTC
TRN  10010101100011001
NAM  O36420_9GAMA/19-278
ASQ  LKR-.--------KRLNSAKSATLKKKKVFLSNSEFFAGVSTNYELGKDFLREMDTPICTSNTVFLPVKFSDVAPGRCLTLSPYGHSSVLGFHCQECKPDSS------------SGFTQAQQSAESNELLSVNLCFLNNVEKVVQHKAFYLSLLGHSMNTVKQSLGQPSLLYCYTVLKKFYPQIFPIFTAN-GPMLTMYIIFTSLTLHVSEAVLRILTDNV-ENHNLSADCYKGHYILSIEPQALEE-SNLNVCVTKICDLVAQLDFSDELKQEYVNGSTLIANF
DSQ  CTCAAGAGG---...------------------------AAAAGATTAAATTCTGCAAAATCAGCCACCCTGAAGAAAAAAAAGGTCTTTTTGTCCAACAGTGAATTTTTTGCAGGGGTTTCTACAAACTATGAGCTGGGCAAAGATTTTTTAAGGGAAATGGATACCCCTATATGCACCTCCAACACTGTCTTTTTACCTGTCAAGTTTTCAGACGTGGCACCAGGCCGATGCCTTACCTTGTCCCCATACGGCCACTCATCTGTCCTGGGGTTCCACTGCCAGGAATGCAAACCTGACAGCTCT------------------------------------TCTGGATTCACCCAGGCCCAGCAATCTGCAGAATCAAATGAGCTGCTATCTGTTAATTTGTGTTTTCTAAATAATGTGGAAAAGGTTGTGCAGCACAAGGCCTTCTACCTGTCTCTCCTGGGACACTCCATGAATACAGTAAAGCAAAGTCTGGGACAACCCTCGCTCTTGTACTGCTATACTGTACTTAAAAAGTTCTATCCACAGATATTTCCAATTTTCACTGCAAAC---GGCCCCATGCTAACCATGTACATTATTTTCACCTCTTTGACCCTGCACGTCAGCGAAGCGGTTCTCAGAATCCTCACAGATAATGTG---GAAAACCACAACTTGTCTGCCGACTGTTACAAAGGTCACTATATCCTGTCTATTGAACCTCAGGCCCTGGAAGAA---TCTAACCTCAACGTATGCGTCACTAAGATCTGTGACCTCGTGGCTCAGCTAGACTTTTCAGATGAATTAAAACAAGAATATGTAAATGGGTCAACCCTAATTGCTAATTTC
TRN  10010101100011000
NAM  O41970_MHV68/23-289
ASQ  GAMS.IRS-----SRTKHSTAQKGAHRRR-VSLAGFFNLIYKRQDLGLDFLREMSEPLCTSRPVLLPLNLKNIAPGRCISLTPFGHTDNLGFQCETCTDPNLN---------KSIPPKLEDPAFSKNELCSVTLTFYQQAEQVIQHKQFYLSLLNLSMDAVRNSLTQPGLLYCYLVTKAFMLEGFPIFFEETNGMLGLYLVFRRDLLHLHESYLRLLIDNL-GNYDISVDSVGRSYIIKLCPVGNVS-RIPTIPADNVCLAVNNLDYGDDVKASWIECFNIVSRL
DSQ  GGCGCCATGTCT...ATTCGCAGC---------------TCCCGCACCAAGCACTCGACCGCCCAGAAGGGGGCACACCGCAGACGG---GTCTCCCTGGCGGGATTTTTTAACCTCATCTACAAGCGCCAGGACCTGGGGCTTGACTTCCTGCGGGAAATGTCAGAGCCCTTATGTACGTCCAGACCCGTCCTCTTGCCACTCAATCTCAAGAATATCGCGCCAGGCCGCTGCATTTCACTGACCCCTTTTGGCCACACGGACAATCTGGGTTTCCAATGTGAAACCTGCACCGACCCAAACCTCAAC---------------------------AAATCAATCCCCCCCAAGTTGGAAGATCCCGCGTTTAGCAAGAACGAGCTCTGTTCGGTGACCCTAACATTTTATCAACAGGCAGAGCAGGTAATACAGCACAAGCAATTTTATTTGTCTCTTTTAAATTTGTCCATGGACGCTGTCAGAAACAGCCTGACCCAGCCCGGGCTCCTGTACTGCTATCTGGTCACAAAGGCCTTTATGCTGGAGGGCTTCCCTATATTCTTTGAGGAAACAAATGGAATGTTGGGACTGTACTTGGTCTTCAGACGCGATCTGCTTCACTTGCACGAGTCCTACCTTCGTCTTCTCATCGATAATCTG---GGCAATTATGACATTTCAGTGGACAGTGTGGGGAGATCTTACATTATCAAACTGTGCCCAGTTGGCAACGTGTCC---AGAATACCTACCATACCGGCCGATAATGTCTGCTTAGCTGTTAACAATCTGGATTATGGGGACGATGTCAAAGCCTCTTGGATTGAATGCTTCAACATTGTATCTCGTCTT
TRN  10010101100011000
NAM  UL31_EBV/52-316
ASQ  RSELgRMERVGSVARSICSRHTRHGVDRSHFSLRDFFRGISANFELGKDFLREMNTPIHVSEAVFLPLSLCTLSPGRCLRLSPFGHSLTLGSHCEICINRSQ--------------------VHVPQEFSSTQLSFFNNVHKIIPNKTFYVSLLSSSPSAVKAGLSQPSLLYAYLVTGHFCGTICPIFSTNGKGRLIMHLLLQGTSLHIPETCLKLLCENIGPTYELAVDLVGDAFCIKVSPRDTVYEKAVNVDEDAIYEAIKDLECGDELRLQIINYTQLILEN
DSQ  CGCTCAGAGCTGggaAGAATGGAAAGGGTTGGCAGTGTGGCCCGATCAATATGTTCCCGGCACACCAGACATGGTGTAGACAGATCCCATTTTTCACTACGGGACTTCTTCAGGGGAATCTCTGCCAACTTTGAGCTGGGCAAAGATTTTCTGCGTGAGATGAACACCCCCATACATGTCTCAGAGGCCGTGTTTCTCCCACTGTCACTGTGCACTCTCTCCCCCGGGCGCTGCCTTCGCCTGTCTCCCTTCGGCCACAGCCTGACTCTGGGGTCTCACTGCGAGATCTGCATCAATAGGTCCCAG------------------------------------------------------------GTTCATGTGCCTCAGGAGTTTAGCTCCACCCAGCTCTCCTTCTTCAACAATGTCCACAAGATAATACCCAACAAGACCTTCTATGTGTCTCTGCTCAGCAGCTCTCCCAGTGCAGTAAAGGCTGGACTTTCCCAACCCAGCCTTCTCTACGCTTACCTGGTCACCGGACACTTTTGTGGCACCATCTGCCCCATCTTCAGCACAAATGGAAAAGGGCGCCTAATCATGCATCTCCTGCTCCAGGGCACCTCCCTTCACATCCCAGAGACCTGCTTGAAACTGTTATGTGAAAACATAGGCCCCACCTACGAGCTGGCCGTGGACCTAGTAGGGGACGCCTTCTGTATAAAGGTCAGCCCCAGAGACACGGTATATGAGAAGGCTGTCAATGTCGACGAAGATGCCATCTACGAGGCCATCAAGGACCTGGAATGTGGGGATGAGCTGCGCCTACAGATCATCAACTATACCCAGCTCATTTTGGAAAAT
TRN  10010101100011000
//