EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02709 - Galactosyl_T_2)
FAM  PF02709
PID  Galactosyl_T_2
DES  Galactosyltransferase
IPR  IPR003859
ANO  9
ALN  330
AID  0.405552
APH  ((((Q92074_CHICK/93-361:0.20859,B4GT2_HUMAN/97-366:0.28857):0.14235,(B4GT4_HUMAN/77-344:0.36809,B4GT3_HUMAN/77-346:0.33246):0.08559):0.22645,((B4GT5_HUMAN/114-381:0.13227,B4GT6_HUMAN/108-375:0.12137):0.30007,Q21608_CAEEL/109-381:0.91895):0.12759):0.21626,BAGT_LYMST/143-462:0.45402,SQV3_CAEEL/1-279:1.43438);
ATP  ((((Q92074_CHICK/93-361,B4GT2_HUMAN/97-366),(B4GT4_HUMAN/77-344,B4GT3_HUMAN/77-346)),((B4GT5_HUMAN/114-381,B4GT6_HUMAN/108-375),Q21608_CAEEL/109-381)),BAGT_LYMST/143-462,SQV3_CAEEL/1-279);
ATL  5.35701
DNO  9
DLN  990
DID  0.480664
DPH  (((((B4GT2_HUMAN/97-366:0.25332,Q92074_CHICK/93-361:0.26413):0.09328,(B4GT3_HUMAN/77-346:0.30276,B4GT4_HUMAN/77-344:0.32302):0.07184):0.13392,BAGT_LYMST/143-462:0.50740):0.12505,(Q21608_CAEEL/109-381:0.56314,SQV3_CAEEL/1-279:0.92079):0.10760):0.22644,B4GT6_HUMAN/108-375:0.15938,B4GT5_HUMAN/114-381:0.18787);
DTP  (((((B4GT2_HUMAN/97-366,Q92074_CHICK/93-361),(B4GT3_HUMAN/77-346,B4GT4_HUMAN/77-344)),BAGT_LYMST/143-462),(Q21608_CAEEL/109-381,SQV3_CAEEL/1-279)),B4GT6_HUMAN/108-375,B4GT5_HUMAN/114-381);
DTL  4.29818
RID  0.405552
RPH  ((((Q92074_CHICK/93-361:0.20859,B4GT2_HUMAN/97-366:0.28857):0.14235,(B4GT4_HUMAN/77-344:0.36809,B4GT3_HUMAN/77-346:0.33246):0.08559):0.22645,((B4GT5_HUMAN/114-381:0.13227,B4GT6_HUMAN/108-375:0.12137):0.30007,Q21608_CAEEL/109-381:0.91895):0.12759):0.21626,BAGT_LYMST/143-462:0.45402,SQV3_CAEEL/1-279:1.43438);
RTP  ((((Q92074_CHICK/93-361,B4GT2_HUMAN/97-366),(B4GT4_HUMAN/77-344,B4GT3_HUMAN/77-346)),((B4GT5_HUMAN/114-381,B4GT6_HUMAN/108-375),Q21608_CAEEL/109-381)),BAGT_LYMST/143-462,SQV3_CAEEL/1-279);
RTL  5.35701
LNK  B4GT2_HUMAN/97-366:O60909:Y12510
LNK  B4GT3_HUMAN/77-346:O60512:AF038661
LNK  B4GT4_HUMAN/77-344:O60513:AF038662
LNK  B4GT5_HUMAN/114-381:O43286:AB004550
LNK  B4GT6_HUMAN/108-375:Q9UBX8:AF097159
LNK  BAGT_LYMST/143-462:Q09323:X80228
LNK  Q21608_CAEEL/109-381:Q21608:X98132
LNK  Q92074_CHICK/93-361:Q92074:U19890
LNK  SQV3_CAEEL/1-279:P34548:AJ005867
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SQV3_CAEEL/1-279
ASQ  MKLKTR-LILSGTILISLAACYFLVLLVLDLEITRDLMTDYVDPRPLQTSYHKLCVIVPYRDRLEELREFSPHMSKFLHNQNVSHHILIINQTDPLRFNRASLINVGWNEADRLGC.-DYMVMNDVDLLPVNPEVPYDFPGI-GVIRHITSPQYHPKYHYEKFIGGILMLTLKDYKKLNGMSNKYWGWGLEDDEFYLRIIDSKLNLTRVSGLSTDSSNTFRHIHG------PKRKRD-----------------------------------------YTPKKNDKNQWEIKRKRDHVSGLHDVRYLIDSRQLLDFSGTSVTIINVALHC
DSQ  ATGAAGCTCAAAACGCGG---TTAATCCTTTCGGGAACCATTTTAATCTCGTTAGCTGCATGTTATTTCTTAGTTCTTTTGGTTCTCGATTTAGAGATAACGAGGGATCTTATGACTGATTATGTAGATCCGCGGCCATTACAAACCAGCTATCATAAACTGTGCGTTATCGTTCCGTATCGAGATCGGCTTGAAGAACTTCGAGAATTTTCTCCCCATATGTCAAAATTTCTACATAATCAAAACGTCTCTCATCACATTTTAATCATCAATCAAACGGATCCTCTTCGATTTAATAGAGCTTCTCTAATAAATGTTGGCTGGAACGAAGCAGATCGTCTTGGATGT...---GACTACATGGTGATGAACGATGTAGATCTGTTGCCTGTCAATCCAGAAGTTCCGTACGATTTTCCGGGAATC---GGTGTGATTCGGCACATAACCTCTCCCCAGTATCATCCGAAATATCACTATGAAAAGTTTATCGGAGGAATATTGATGCTGACACTGAAAGATTACAAAAAACTAAATGGAATGTCGAATAAGTATTGGGGATGGGGACTTGAAGACGATGAGTTTTATCTCAGAATTATCGACAGCAAGCTCAATCTAACTCGAGTTTCTGGTCTATCAACAGATAGTTCAAACACTTTTCGGCATATTCATGGA------------------CCAAAAAGAAAAAGAGAT---------------------------------------------------------------------------------------------------------------------------TATACTCCAAAGAAAAATGATAAGAATCAATGGGAGATTAAACGGAAAAGAGATCATGTATCCGGTCTCCACGACGTCCGCTACCTCATCGATAGTCGCCAACTCCTCGACTTTTCTGGAACTTCAGTTACCATTATCAATGTCGCCTTACACTGC
TRN  10010101100011000
NAM  Q92074_CHICK/93-361
ASQ  CPDPSP--LLVGPLRVEFSQP--VNLEEVASTNPEVREGGRFAPKDCKA-LQKVAIIIPFRNREEHLKYWLYYMHPILQRQQLDYGVYVINQDGDEEFNRAKLLNVGFTEALKEYD.YDCFVFSDVDLIPMDDRNTYKCYSQ-PRHLSVSMDKFGFRLPYNQYFGGVSALSKEQFTKINGFPNNYWGWGGEDDDIYNRLVFKGMGISRPD-AVIGKCRMIRHS--------RDRKNE-------------------------------------------PNPERFDRIAHTRETMSSDGLNSLSYE-VLRTDRFPLYTRITVDIG-APG
DSQ  TGCCCGGACCCGTCCCCG------CTGCTCGTCGGACCGCTGCGCGTGGAGTTCTCCCAGCCT------GTGAACCTGGAGGAGGTGGCGAGCACAAACCCTGAGGTCAGGGAGGGAGGTCGTTTTGCTCCAAAGGACTGCAAGGCG---CTGCAGAAAGTAGCAATCATCATCCCGTTCCGAAACCGAGAGGAGCATCTGAAGTACTGGCTCTATTACATGCACCCAATTCTTCAAAGGCAGCAGCTAGATTATGGAGTGTATGTCATCAACCAGGATGGAGACGAAGAATTTAACCGTGCTAAACTGCTGAATGTAGGATTCACGGAAGCTTTGAAGGAGTATGAC...TATGACTGCTTTGTGTTTAGTGATGTAGACCTGATCCCAATGGATGACAGGAACACCTACAAGTGCTACAGCCAA---CCAAGGCACCTTTCTGTCTCCATGGATAAATTCGGATTTCGGTTACCCTACAATCAGTATTTTGGAGGTGTGTCTGCCTTGAGCAAAGAACAATTCACGAAGATCAATGGGTTTCCAAACAATTACTGGGGCTGGGGAGGCGAAGATGATGACATCTACAACAGGCTGGTGTTCAAAGGCATGGGCATATCTCGGCCAGAT---GCTGTCATTGGGAAATGCAGAATGATTCGCCACTCG------------------------CGTGATCGGAAGAACGAG---------------------------------------------------------------------------------------------------------------------------------CCCAACCCGGAGAGGTTTGACCGTATTGCTCACACCAGGGAGACGATGAGCTCTGATGGCTTGAACTCGCTCTCCTACGAG---GTGCTAAGGACTGACAGGTTCCCTCTGTACACGAGGATCACAGTGGATATCGGA---GCGCCCGGC
TRN  10010101100011010
NAM  B4GT2_HUMAN/97-366
ASQ  CPDSPP--GLVGRLLIEFTSP--MPLERVQRENPGVLMGGRYTPPDCTP-AQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAaYDCFIFSDVDLVPMDDRNLYRCGDQ-PRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD-IRIGRYRMIKHD--------RDKHNE-------------------------------------------PNPQRFTKIQNTKLTMKRDGIGSVRYQ-VLEVSRQPLFTNITVDIG-RPP
DSQ  TGTCCTGACTCGCCACCT------GGTCTTGTGGGCAGACTGCTGATCGAGTTCACCTCACCC------ATGCCCCTGGAGCGGGTGCAGAGGGAGAACCCAGGCGTGCTCATGGGCGGCCGATACACACCGCCCGACTGCACCCCA---GCCCAGACGGTGGCGGTCATCATCCCCTTTAGACACCGGGAACACCACCTGCGCTACTGGCTCCACTATCTACACCCCATCTTGAGGCGGCAGCGGCTGCGCTACGGCGTCTATGTCATCAACCAGCATGGTGAGGACACCTTCAACCGGGCCAAGCTGCTTAACGTGGGCTTCCTAGAGGCGCTGAAGGAGGATGCCgccTATGACTGCTTCATCTTCAGCGATGTGGACCTGGTCCCCATGGATGACCGCAACCTATACCGCTGCGGCGACCAA---CCCCGCCACTTTGCCATTGCCATGGACAAGTTTGGCTTCCGGCTTCCCTATGCTGGCTACTTTGGAGGTGTGTCAGGCCTGAGTAAGGCTCAGTTTCTGAGAATCAATGGCTTCCCCAATGAGTACTGGGGCTGGGGTGGCGAGGATGATGACATCTTCAACCGGATCTCCCTGACTGGGATGAAGATCTCACGCCCAGAC---ATCCGAATCGGCCGCTACCGCATGATCAAGCACGAC------------------------CGCGACAAGCATAACGAA---------------------------------------------------------------------------------------------------------------------------------CCTAACCCTCAGAGGTTTACCAAGATTCAAAACACGAAGCTGACCATGAAGCGGGACGGCATTGGGTCAGTGCGGTACCAG---GTCTTGGAGGTGTCTCGGCAACCACTCTTCACCAATATCACAGTGGACATTGGG---CGGCCTCCG
TRN  10010101100011001
NAM  B4GT4_HUMAN/77-344
ASQ  CPSVSP--YLRGQSKLIFKPD--LTLEEVQAENPKVSRG-RYRPQECKA-LQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEEN.WDCFIFHDVDLVPENDFNLYKCEEH-PKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPL-PEVGKYTMVFHT--------RDKGNE-------------------------------------------VNAERMKLLHQVSRVWRTDGLSSCSYK-LVSVEHNPLYINITVDFW-FGA
DSQ  TGCCCTTCTGTGTCTCCT------TACCTCAGAGGCCAGAGCAAGCTCATTTTCAAACCAGAT------CTCACTTTGGAAGAGGTACAGGCAGAAAATCCCAAAGTGTCCAGAGGC---CGGTATCGCCCTCAGGAATGTAAAGCT---TTACAGAGGGTCGCCATCCTCGTTCCCCACCGGAACAGAGAGAAACACCTGATGTACCTGCTGGAACATCTGCATCCCTTCCTGCAGAGGCAGCAGCTGGATTATGGCATCTACGTCATCCACCAGGCTGAAGGTAAAAAGTTTAATCGAGCCAAACTCTTGAATGTGGGCTATCTAGAAGCCCTCAAGGAAGAAAAT...TGGGACTGCTTTATATTCCACGATGTGGACCTGGTACCCGAGAATGACTTTAACCTTTACAAGTGTGAGGAGCAT---CCCAAGCATCTGGTGGTTGGCAGGAACAGCACTGGGTACAGGTTACGTTACAGTGGATATTTTGGGGGTGTTACTGCCCTAAGCAGAGAGCAGTTTTTCAAGGTGAATGGATTCTCTAACAACTACTGGGGATGGGGAGGCGAAGACGATGACCTCAGACTCAGGGTTGAGCTCCAAAGAATGAAAATTTCCCGGCCCCTG---CCTGAAGTGGGTAAATATACAATGGTCTTCCACACT------------------------AGAGACAAAGGCAATGAG---------------------------------------------------------------------------------------------------------------------------------GTGAACGCAGAACGGATGAAGCTCTTACACCAAGTGTCACGAGTCTGGAGAACAGATGGGTTGAGTAGTTGTTCTTATAAA---TTAGTATCTGTGGAACACAATCCTTTATATATCAACATCACAGTGGATTTCTGG---TTTGGTGCA
TRN  10010101100011000
NAM  B4GT3_HUMAN/77-346
ASQ  CPERSP--LLVGPVSVSFSPV--PSLAEIVERNPRVEPGARYRPAGCEP-RSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEE.WDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNSFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPP-TSVGHYKMVKHR--------GDKGNE-------------------------------------------ENPHRFDLLVRTQNSWTQDGMNSLTYQ-LLARELGPLYTNITADIG-TDP
DSQ  TGTCCAGAACGATCTCCT------CTCTTAGTGGGTCCTGTGTCGGTGTCCTTTAGCCCAGTG------CCATCACTGGCAGAGATTGTGGAGCGGAATCCCCGGGTAGAACCAGGGGCCCGGTACCGCCCTGCAGGTTGTGAGCCC---CGCTCCCGAACAGCCATCATTGTGCCTCATCGTGCCCGGGAGCACCACCTGCGCCTGCTGCTCTACCACCTGCACCCCTTCTTGCAGCGCCAGCAGCTTGCTTATGGCATCTATGTCATCCACCAGGCTGGAAATGGAACATTTAACAGGGCAAAACTGTTGAACGTTGGGGTGCGAGAGGCCCTGCGTGATGAAGAG...TGGGACTGCCTGTTCTTGCACGATGTGGACCTCTTGCCAGAAAATGACCACAATCTGTATGTGTGTGACCCCCGGGGACCCCGCCATGTTGCCGTTGCTATGAACAGTTTTGGATACAGCCTCCCGTACCCCCAGTACTTCGGAGGAGTCTCAGCACTTACTCCTGACCAGTACCTGAAGATGAATGGCTTCCCCAATGAATACTGGGGCTGGGGTGGTGAGGATGACGACATTGCTACCAGGGTGCGCCTGGCTGGGATGAAGATCTCTCGGCCCCCC---ACATCTGTAGGACACTATAAGATGGTGAAGCACCGA------------------------GGAGATAAGGGCAATGAG---------------------------------------------------------------------------------------------------------------------------------GAAAATCCCCACAGATTTGACCTCCTGGTCCGTACCCAGAATTCCTGGACGCAAGATGGGATGAACTCACTGACATACCAG---TTGCTGGCTCGAGAGCTGGGGCCTCTTTATACCAACATCACAGCAGACATTGGG---ACTGACCCT
TRN  10010101100011000
NAM  B4GT5_HUMAN/114-381
ASQ  CPERLP--SMKGPIDINMSEIGMDYIHELFSKDPTIKLGGHWKPSDCMP-RWKVAILIPFRNRHEHLPVLFRHLLPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKDLD.WDCLIFHDVDHIPESDRNYYGCGQM-PRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPE-GDTGKYKSIPH---------HHRGEV-------------------------------------------QFLGRYALLRKSKERQGLDGLNNLNY--FANITYDALYKNITVNL--TPE
DSQ  TGCCCTGAAAGACTCCCT------TCCATGAAGGGCCCAATAGACATAAACATGAGTGAAATTGGAATGGATTACATTCATGAACTCTTCTCCAAAGACCCAACCATCAAGCTCGGAGGTCACTGGAAGCCTTCTGATTGCATGCCT---CGGTGGAAGGTGGCGATCCTTATCCCCTTCCGGAACCGCCACGAGCACCTCCCAGTCCTGTTCAGACACCTGCTTCCCATGCTCCAGCGCCAGCGCCTGCAGTTTGCATTTTATGTGGTTGAACAAGTTGGTACCCAACCCTTTAATCGAGCCATGCTTTTCAACGTTGGCTTTCAAGAAGCAATGAAAGACTTGGAT...TGGGACTGTTTGATTTTTCATGATGTAGATCACATACCGGAAAGTGATCGCAACTATTATGGATGTGGACAGATG---CCGAGGCATTTTGCAACCAAATTGGATAAGTATATGTATCTGCTTCCTTATACCGAGTTCTTTGGCGGAGTGAGTGGCTTAACAGTGGAACAATTTCGGAAAATCAATGGCTTTCCTAATGCTTTCTGGGGTTGGGGTGGAGAAGATGACGACCTCTGGAACAGAGTACAGAATGCAGGCTATTCTGTGAGCCGGCCAGAG---GGTGACACAGGAAAGTACAAGTCCATTCCTCAT---------------------------CACCATCGAGGAGAAGTC---------------------------------------------------------------------------------------------------------------------------------CAGTTTCTTGGAAGGTATGCTCTGCTGAGGAAGTCAAAAGAACGGCAAGGGCTGGATGGCCTCAACAACCTGAACTAC------TTTGCAAACATCACATACGACGCCTTGTATAAAAACATAACTGTCAACCTG------ACACCCGAG
TRN  10010101100011000
NAM  B4GT6_HUMAN/108-375
ASQ  CPEKLP--YMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKP-RWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDSV.WDCVIFHDVDHLPENDRNYYGCGEM-PRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPE-GDLGKYKSIPH---------HHRGEV-------------------------------------------QFLGRYKLLRYSKERQYIDGLNNLIYR--PKILVDRLYTNISVNL--MPE
DSQ  TGTCCAGAAAAGCTGCCT------TATATGCGAGGATTCCTCAATGTCAATGTAAGCGAAGTCAGTTTTGATGAAATTCATCAACTCTTCTCCAAGGATTTAGATATTGAGCCAGGGGGTCATTGGAGGCCAAAAGACTGTAAACCC---AGATGGAAGGTGGCAGTTCTCATTCCTTTCCGTAATCGCCATGAACATCTTCCAATTTTTTTCTTACATCTGATTCCAATGCTCCAGAAGCAGCGGCTGGAATTTGCGTTTTATGTCATTGAACAGACTGGCACACAACCTTTTAACCGTGCGATGCTTTTCAATGTGGGCTTCAAAGAGGCCATGAAAGACAGTGTC...TGGGACTGTGTAATCTTCCACGATGTGGATCATCTACCTGAAAATGACCGGAACTATTACGGATGTGGAGAAATG---CCACGTCATTTTGCTGCAAAGCTGGATAAATACATGTATATTCTTCCATATAAAGAATTTTTTGGTGGTGTAAGTGGGCTGACAGTGGAACAATTTAGAAAGATCAATGGTTTTCCTAATGCCTTCTGGGGATGGGGAGGAGAAGATGATGACCTTTGGAACAGAGTTCACTATGCTGGATATAATGTAACCAGACCAGAG---GGAGACTTAGGAAAATACAAGTCAATTCCTCAT---------------------------CACCATAGAGGTGAAGTC---------------------------------------------------------------------------------------------------------------------------------CAGTTTTTAGGACGGTATAAATTACTAAGGTATTCCAAGGAGCGTCAGTACATCGATGGACTGAACAATTTAATATATAGG------CCAAAAATACTGGTTGATAGGTTGTATACAAACATATCTGTAAACCTC------ATGCCAGAG
TRN  10010101100011000
NAM  BAGT_LYMST/143-462
ASQ  CPIRPP--ALAGRFVPSKKSS---TYHELAAMFPDVQDGGHYTPRMCTP-AEKTAIIIPYRNRCRHLYTLLPNLIPMLMRQNVDFTIFVIEQTTPETFNKGILFNAGYLEALKVDN.YDCFILHDVDMIPIDDRNMYRCNKMGPVHFSPGVNKFKYKLFYSGLFGGVVGFTREQFRLINGASNLYFGWGGEDDDLRNRAVHMKLPLLRKT-LAHGLYDMVSHVEAGWNVNPHSKGAHSLYDMLNKALGVQAGWNVHPNSKWPLRLFDSVNHAPAEGAGWNVNPDRFKIYSTSRQRQHVDGINSLVYN-VTWYRTSPLYTWVGVGFN-KTV
DSQ  TGTCCGATTCGACCACCT------GCCTTAGCTGGAAGGTTCGTACCCTCAAAAAAGAGTTCT---------ACGTATCACGAGCTAGCCGCCATGTTTCCTGACGTCCAAGATGGCGGCCACTACACGCCCCGGATGTGCACGCCA---GCAGAAAAGACCGCCATCATCATCCCGTACCGGAACAGATGTCGTCATCTGTACACACTTCTACCTAACCTGATTCCGATGTTGATGAGACAAAATGTGGACTTTACCATCTTTGTTATTGAACAGACTACACCCGAGACTTTCAACAAAGGGATTCTATTCAACGCCGGATATCTCGAGGCCCTGAAAGTGGATAAC...TACGACTGTTTTATCCTGCATGACGTCGACATGATTCCCATCGATGACCGGAACATGTATAGGTGCAACAAGATGGGACCGGTGCACTTCTCTCCCGGAGTCAACAAATTCAAATACAAACTTTTTTATTCTGGTCTGTTTGGGGGCGTGGTGGGCTTCACCAGGGAGCAGTTCAGGTTGATCAACGGGGCGTCAAATCTTTACTTTGGCTGGGGCGGTGAAGATGACGATCTCAGAAACAGGGCCGTCCACATGAAGTTGCCACTGTTGAGGAAGACC---TTGGCGCACGGCCTGTACGACATGGTGAGCCACGTAGAGGCAGGCTGGAATGTGAACCCGCACAGCAAAGGGGCGCACAGCCTGTATGACATGTTGAACAAGGCGCTTGGGGTACAGGCAGGCTGGAACGTGCACCCGAACAGCAAATGGCCGCTGAGACTGTTTGACAGTGTGAACCACGCGCCTGCGGAAGGGGCAGGCTGGAACGTGAACCCGGACAGATTTAAGATCTACAGTACAAGCCGGCAAAGACAACACGTCGACGGTATCAATTCATTGGTGTACAAT---GTCACGTGGTACAGGACGTCGCCATTGTACACGTGGGTCGGAGTCGGATTCAAT---AAAACCGTC
TRN  10010101100011000
NAM  Q21608_CAEEL/109-381
ASQ  CPIVEKIPDLQGALPQATLLIQNLQEGEVHAIHPELGPGGSWKPDDCQA-RDKIAVIIPYRERQTHLTRLIDFLIPILQRQRLDFRFIVTEQYGNDLFNKGRIMNAAFIFAESLGV.-DCVVFHDVDMFPQDDRNPYSCPPG-PRHLGAFVSNLGYQLWYKEIVGGVLAVSMADYRAVNGYSNQFWAWGGEDDDMGQRILSLNYTIERPN-PETGRYSMLKHVK-------RKRTAP-------------------------------------------KLIYKLLGN--SANRVAYDGLNETDKWTIRKVTTRPLYYHLYVDVGPVPE
DSQ  TGTCCAATAGTTGAGAAAATACCAGATCTTCAAGGCGCTCTTCCACAAGCCACACTTTTGATTCAAAATCTTCAAGAAGGAGAAGTACACGCAATTCATCCAGAACTTGGCCCAGGTGGCTCATGGAAACCGGATGATTGTCAGGCT---CGCGATAAAATCGCAGTGATAATTCCATATCGAGAAAGGCAAACTCACTTGACTCGATTGATCGACTTTTTGATTCCAATACTTCAACGACAGCGGCTAGATTTTCGATTCATTGTTACTGAACAATATGGAAACGACTTGTTCAACAAAGGCCGAATTATGAATGCTGCATTTATCTTCGCAGAAAGCCTTGGAGTC...---GATTGTGTAGTCTTCCACGACGTCGACATGTTCCCACAAGACGATCGGAACCCGTATTCGTGCCCACCTGGT---CCACGTCATCTTGGAGCTTTTGTCAGTAATCTGGGATATCAATTGTGGTACAAGGAGATTGTCGGAGGCGTTTTAGCAGTATCAATGGCAGATTATCGTGCAGTTAATGGATATTCAAATCAATTCTGGGCGTGGGGAGGTGAAGACGATGATATGGGACAGAGAATACTTTCATTAAATTACACAATTGAACGACCAAAT---CCTGAAACAGGGAGATATTCTATGTTGAAGCATGTGAAG---------------------AGGAAACGGACTGCGCCG---------------------------------------------------------------------------------------------------------------------------------AAGTTGATCTACAAGCTTCTCGGGAAC------AGTGCAAATCGTGTTGCGTACGATGGATTGAACGAAACCGATAAATGGACGATTCGAAAGGTCACAACACGTCCGCTCTACTATCATCTTTATGTTGACGTGGGCCCAGTTCCTGAA
TRN  10010101100011000
//