EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02694 - UPF0060)
FAM  PF02694
PID  UPF0060
DES  Uncharacterized BCR, YnfA/UPF0060 family
IPR  IPR003844
ANO  4
ALN  109
AID  0.447176
APH  ((Y793_SYNY3/2-108:0.26501,Y2672_MYCBO/2-109:0.63190):0.09108,YFJF_BACSU/2-109:0.38768,YNFA_ECOLI/1-108:0.90351);
ATP  ((Y793_SYNY3/2-108,Y2672_MYCBO/2-109),YFJF_BACSU/2-109,YNFA_ECOLI/1-108);
ATL  2.27916
DNO  4
DLN  327
DID  0.496087
DPH  (Y793_SYNY3/2-108:0.29348,(YFJF_BACSU/2-109:0.27443,YNFA_ECOLI/1-108:0.61466):0.09411,Y2672_MYCBO/2-109:0.53374);
DTP  (Y793_SYNY3/2-108,(YFJF_BACSU/2-109,YNFA_ECOLI/1-108),Y2672_MYCBO/2-109);
DTL  1.81042
RID  0.447176
RPH  ((Y793_SYNY3/2-108:0.26501,Y2672_MYCBO/2-109:0.63190):0.09108,YFJF_BACSU/2-109:0.38768,YNFA_ECOLI/1-108:0.90351);
RTP  ((Y793_SYNY3/2-108,Y2672_MYCBO/2-109),YFJF_BACSU/2-109,YNFA_ECOLI/1-108);
RTL  2.27916
LNK  Y2672_MYCBO/2-109:P67147:BX248343
LNK  Y793_SYNY3/2-108:Q55939:D64005
LNK  YFJF_BACSU/2-109:O31553:Z99108
LNK  YNFA_ECOLI/1-108:P76169:U00096
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Y2672_MYCBO/2-109
ASQ  VVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGRVLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAP-RG
DSQ  GTGGTGCGGTCAATCCTGCTATTCGTCCTGGCGGCGGTTGCGGAGATCGGTGGCGCGTGGCTGGTATGGCAGGGCGTCCGCGAGCAACGGGGTTGGCTTTGGGCGGGACTCGGAGTTATTGCGCTTGGGGTCTATGGGTTCTTCGCCACATTGCAGCCGGACGCCCATTTCGGTCGGGTCTTGGCCGCCTACGGTGGTGTGTTTGTCGCCGGTTCGCTCGCCTGGGGCATGGCCCTGGACGGGTTCCGGCCCGACCGGTGGGATGTCATCGGTGCCCTTGGCTGCATGGCCGGGGTAGCCGTGATCATGTACGCCCCT---CGCGGC
TRN  11011111101111101
NAM  Y793_SYNY3/2-108
ASQ  ILRSLLYFVMAGLCEIGGGYLVWLWIREGKSVWLALVRAILLTVYGFVATLQP-ANFGRAYAAYGGIFIILSIIWGWQVDNVVVDRLDWLGAAIALVGVLVMMYAN-RA
DSQ  ATTCTGCGATCACTGCTTTATTTTGTCATGGCGGGTTTGTGTGAAATTGGGGGCGGATACTTAGTTTGGTTATGGATACGGGAAGGTAAAAGTGTTTGGTTGGCATTAGTTAGAGCAATTTTACTCACCGTATATGGATTTGTAGCAACGCTTCAACCT---GCCAACTTTGGGCGAGCCTATGCCGCCTATGGCGGAATTTTCATCATCCTCTCCATTATCTGGGGATGGCAAGTAGACAATGTGGTAGTCGATCGCCTGGACTGGCTTGGAGCGGCGATCGCCTTGGTTGGTGTATTAGTGATGATGTATGCTAAC---AGGGCT
TRN  10010101100011000
NAM  YFJF_BACSU/2-109
ASQ  MLITILLFLAAGLAEIGGGYLVWLWLREAKPAGYGIAGALILIVYGILPTFQSFPSFGRVYAAYGGVFIVLAVLWGWLVDRKTPDLYDWIGAFICLIGVCVILFAP-RG
DSQ  ATGCTGATTACCATTCTTTTATTTCTCGCGGCAGGGCTTGCTGAAATTGGCGGCGGATATCTGGTTTGGCTATGGCTGAGAGAGGCAAAGCCAGCTGGCTACGGAATCGCCGGGGCGCTGATCCTCATTGTATACGGCATTCTTCCGACGTTTCAGTCCTTCCCATCTTTCGGCCGTGTATACGCCGCTTATGGCGGAGTATTCATCGTGCTTGCGGTCCTGTGGGGATGGCTTGTTGACCGGAAAACACCTGATCTGTATGACTGGATCGGCGCATTCATTTGTCTCATCGGTGTCTGTGTTATTTTATTTGCGCCG---CGCGGA
TRN  10010101100011010
NAM  YNFA_ECOLI/1-108
ASQ  MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHP-AASGRVYAAYGGVYVCTALMWLRVVDGVKLTLYDWTGALIALCGMLIIVAGWGRT
DSQ  ATGATTAAAACAACGTTACTATTTTTTGCTACTGCGCTGTGTGAAATTATTGGATGCTTTCTGCCCTGGTTGTGGTTAAAACGAAACGCCAGTATCTGGCTGTTGCTTCCGGCGGGGATTTCACTGGCGCTGTTTGTCTGGTTGTTAACGTTGCATCCA---GCGGCGAGTGGGCGTGTTTACGCGGCTTATGGTGGCGTTTATGTCTGCACGGCGTTGATGTGGCTGCGCGTTGTGGATGGCGTGAAACTGACTCTTTATGACTGGACGGGTGCGTTGATTGCGCTTTGCGGCATGTTGATCATTGTTGCGGGCTGGGGGCGCACG
TRN  11011101101011000
//