EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02659 - DUF204)
FAM  PF02659
PID  DUF204
DES  Domain of unknown function DUF
IPR  IPR003810
ANO  6
ALN  77
AID  0.29543
APH  (YWLD_BACSU/108-179:0.43023,(YEBN_ECOLI/108-179:0.60619,Y1812_METTH/103-174:0.55378):0.57383,(YWLD_BACSU/12-86:0.96055,(YEBN_ECOLI/6-82:0.94325,Y1812_METTH/6-82:0.49540):0.69354):0.49845);
ATP  (YWLD_BACSU/108-179,(YEBN_ECOLI/108-179,Y1812_METTH/103-174),(YWLD_BACSU/12-86,(YEBN_ECOLI/6-82,Y1812_METTH/6-82)));
ATL  5.75522
DNO  4
DLN  231
DID  0.411944
DPH  ((YWLD_BACSU/12-86:0.51067,Y1812_METTH/6-82:0.63982):0.21885,Y1812_METTH/103-174:0.58193,YWLD_BACSU/108-179:0.50388);
DTP  ((YWLD_BACSU/12-86,Y1812_METTH/6-82),Y1812_METTH/103-174,YWLD_BACSU/108-179);
DTL  2.45514
RID  0.282192
RPH  (YWLD_BACSU/108-179:0.23417,Y1812_METTH/103-174:1.27854,(Y1812_METTH/6-82:1.13964,YWLD_BACSU/12-86:1.13601):0.64727);
RTP  (YWLD_BACSU/108-179,Y1812_METTH/103-174,(Y1812_METTH/6-82,YWLD_BACSU/12-86));
RTL  4.43575
LNK  Y1812_METTH/103-174:O27840:AE000934
LNK  Y1812_METTH/6-82:O27840:AE000934
LNK  YEBN_ECOLI/108-179:P76264:
LNK  YEBN_ECOLI/6-82:P76264:
LNK  YWLD_BACSU/108-179:P39154:Z38002
LNK  YWLD_BACSU/12-86:P39154:Z38002
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YWLD_BACSU/108-179
ASQ  LLLFAIGVSLDSF--SVGLSLGIYGSHP---LLTITLFGLFSMMLTWLGLLVGKQVQSWLGTYSEALGGIILIVFGL
DSQ  TTATTGCTGTTTGCCATCGGCGTCAGCCTTGACAGCTTT------TCCGTCGGCTTGAGCTTGGGGATATACGGCTCGCATCCG---------CTCCTCACAATTACCCTGTTCGGGCTGTTCAGCATGATGTTGACATGGCTGGGCCTGCTGGTCGGAAAACAAGTGCAGTCATGGCTTGGCACATACAGCGAAGCGCTCGGGGGCATCATATTAATCGTGTTTGGATTA
TRN  10010101100011000
NAM  Y1812_METTH/103-174
ASQ  LLVLSIATSIDAF--AVGVSFALLDI---SIWLPVIVIGLITFILSLAGSYIGERVGHIFENRLEALGGLILILIGL
DSQ  CTCCTTGTACTCTCAATTGCAACCAGCATCGATGCCTTC------GCAGTGGGTGTGAGCTTCGCCCTCCTTGACATA---------TCCATATGGCTCCCGGTAATTGTCATAGGTCTCATCACATTCATACTATCACTTGCCGGTAGCTACATAGGCGAGAGGGTGGGCCACATATTTGAAAACCGTCTTGAGGCCCTTGGAGGCCTGATCCTCATCCTCATCGGTCTT
TRN  10010101100011001
NAM  YEBN_ECOLI/108-179
ASQ  LVTTAIATSLDAM--AVGVGLAFLQV---NIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGV
NAM  YWLD_BACSU/12-86
ASQ  LSIMAFALGMDAF--SVGLGMGMVKLRKKQIFYIGFIIGLFHVIMPLAGMAAGNMLSGLLGVLAVYIGGALLFVLGV
DSQ  TTAAGCATCATGGCGTTTGCTTTAGGGATGGATGCTTTT------TCTGTCGGCCTTGGAATGGGCATGGTCAAACTTAGAAAGAAGCAGATATTCTATATTGGTTTCATCATCGGCCTCTTTCACGTCATCATGCCTCTCGCAGGGATGGCGGCCGGTAACATGCTGTCAGGGCTCCTCGGCGTGTTAGCGGTTTATATCGGTGGGGCGCTGCTTTTTGTTCTTGGGGTT
TRN  10010101100011000
NAM  Y1812_METTH/6-82
ASQ  MVLIGVGLAMDAFSISVSRGLALHESETNYALISALSFGTFQAAMPVLGWVSGLEIQRLVSALAPWAAFILLLIIGL
DSQ  ATGGTGCTCATAGGAGTTGGCCTTGCAATGGACGCCTTCAGCATATCTGTGAGCCGGGGCCTTGCACTCCATGAATCAGAGACAAACTACGCCCTGATATCCGCACTATCCTTCGGAACCTTCCAGGCTGCCATGCCAGTTCTTGGATGGGTGTCTGGTCTTGAAATCCAGAGGCTCGTATCAGCCCTTGCACCCTGGGCAGCATTCATTTTGCTCCTCATAATAGGCCTT
TRN  10010101100011001
NAM  YEBN_ECOLI/6-82
ASQ  TVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGMLASRFVLEWNHWIAFVLLIFLGG
//