EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02613 - Nitrate_red_del)
FAM  PF02613
PID  Nitrate_red_del
DES  Nitrate reductase delta subunit
IPR  IPR003765
ANO  5
ALN  166
AID  0.340715
APH  (P71994_MYCTU/258-415:0.34724,O06561_MYCTU/1-161:0.14280,((NARJ_ECOLI/3-166:0.17490,NARW_ECOLI/3-159:0.42649):0.99355,NARJ_BACSU/9-170:0.86086):0.61715);
ATP  (P71994_MYCTU/258-415,O06561_MYCTU/1-161,((NARJ_ECOLI/3-166,NARW_ECOLI/3-159),NARJ_BACSU/9-170));
ATL  3.56299
DNO  5
DLN  498
DID  0.456348
DPH  (P71994_MYCTU/258-415:0.17314,O06561_MYCTU/1-161:0.20903,((NARJ_ECOLI/3-166:0.26120,NARW_ECOLI/3-159:0.29052):0.49817,NARJ_BACSU/9-170:0.52029):0.42420);
DTP  (P71994_MYCTU/258-415,O06561_MYCTU/1-161,((NARJ_ECOLI/3-166,NARW_ECOLI/3-159),NARJ_BACSU/9-170));
DTL  2.37655
RID  0.340715
RPH  (P71994_MYCTU/258-415:0.34724,O06561_MYCTU/1-161:0.14280,((NARJ_ECOLI/3-166:0.17490,NARW_ECOLI/3-159:0.42649):0.99355,NARJ_BACSU/9-170:0.86086):0.61715);
RTP  (P71994_MYCTU/258-415,O06561_MYCTU/1-161,((NARJ_ECOLI/3-166,NARW_ECOLI/3-159),NARJ_BACSU/9-170));
RTL  3.56299
LNK  NARJ_BACSU/9-170:P42178:Z49884
LNK  NARJ_ECOLI/3-166:P11351:M20147
LNK  NARW_ECOLI/3-159:P19317:X17110
LNK  O06561_MYCTU/1-161:O06561:BX842575
LNK  P71994_MYCTU/258-415:P71994:BX842577
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  P71994_MYCTU/258-415
ASQ  VWQCASVLLTYPN---SRQLGTAEELLAHIDGP-----AADLLGRTVSELRRADPLTAATRYVDTFDLRGRATLYLTYWTAGDTRNRGREMLAFAQTYRSTDVAPPRGETPDFLPVVLEFAATVDPEAGRRLLSGYRVPIAALCNALTEAALPYAHTVAAVCRTGD
DSQ  GTGTGGCAATGCGCCTCGGTGCTGCTGACCTACCCGAAC---------TCACGGCAACTCGGCACCGCAGAGGAATTGCTGGCCCACATCGACGGTCCG---------------GCCGCGGATCTGTTGGGGCGCACGGTCTCTGAGCTGCGCCGTGCCGATCCGCTGACCGCGGCGACCCGCTACGTCGACACCTTCGACCTGCGAGGCCGCGCCACCCTGTACCTGACCTACTGGACCGCCGGCGACACCCGCAACCGCGGCCGGGAGATGCTGGCCTTCGCCCAGACCTACCGCAGCACCGACGTCGCACCACCGCGCGGCGAGACCCCGGACTTCCTGCCGGTGGTGCTCGAATTCGCCGCGACCGTCGACCCCGAGGCGGGGCGACGGTTGCTGAGCGGGTACCGGGTGCCCATCGCCGCGCTGTGCAATGCCCTGACCGAGGCCGCATTGCCATACGCACACACGGTGGCCGCGGTATGCCGGACGGGTGAC
TRN  11011111101111101
NAM  O06561_MYCTU/1-161
ASQ  MWQSASLLLAYPDDGLAERLHMVDALRAHQTGP-----AAALLGRTVAELRALAPMAAAAQYVETFDMRRRSTMYLTYWTAGDTRNRGREMLAFATAYRDAGVKPPRTEAPDYLPVVLEFAATVDPEAGRRLLTEHRVPIDVLRGALADAKSPYEYTVAAICETLP
DSQ  GTGTGGCAGTCGGCCTCGCTACTGCTGGCCTATCCGGATGACGGGCTGGCCGAGCGGCTGCACATGGTCGATGCGCTGCGCGCCCACCAAACGGGCCCG---------------GCGGCGGCGCTGCTAGGGCGAACGGTAGCGGAGTTGCGTGCCCTGGCGCCGATGGCCGCGGCGGCGCAGTACGTCGAGACCTTCGATATGCGACGCCGATCCACGATGTATCTGACGTACTGGACCGCCGGGGACACCCGCAACCGCGGCCGGGAGATGCTGGCGTTCGCCACCGCCTATCGAGACGCCGGCGTCAAGCCGCCGCGTACCGAGGCGCCCGACTACCTGCCCGTCGTGCTCGAGTTCGCCGCCACCGTCGACCCCGAGGCCGGACGTCGGCTGCTGACCGAGCACCGTGTGCCGATCGACGTGTTGCGCGGCGCGCTGGCCGACGCCAAGTCACCCTATGAGTACACCGTGGCGGCGATCTGCGAGACACTGCCC
TRN  11011111101111101
NAM  NARJ_BACSU/9-170
ASQ  TFSALSCLLSYPDEEWRAELPDWKALIQEIGNR----QIREKLLHFFETSASYSPEALIEHYVYTFDFGKKTNMYVTYFNSGEQRERGIELLHLKNTYEQSGFLPTEKELPDYLPLMLEFAAAAEIEAARSVFEKYLSNVRELASRLEKNDSIYAELLHVLLAALE
DSQ  ACGTTCTCTGCTCTTTCCTGTCTTCTCTCTTATCCGGATGAAGAGTGGAGAGCCGAGCTTCCCGATTGGAAGGCTCTTATCCAAGAAATCGGCAACCGG------------CAAATCCGGGAGAAGCTGCTGCACTTTTTCGAGACGTCAGCCAGCTATTCTCCGGAAGCGCTGATTGAACACTATGTCTATACATTCGACTTCGGGAAAAAAACAAATATGTATGTCACCTACTTTAACTCAGGCGAGCAAAGGGAACGCGGCATTGAATTGCTGCATTTAAAAAACACATACGAGCAATCCGGTTTCCTGCCGACAGAGAAAGAGCTGCCTGATTATCTGCCGCTGATGCTGGAATTTGCTGCGGCTGCAGAAATTGAAGCAGCGAGAAGCGTGTTTGAGAAATATCTGTCCAATGTGAGGGAGCTGGCATCCCGTCTCGAAAAAAATGACAGTATATACGCTGAACTGCTGCACGTGCTGCTGGCCGCGCTTGAA
TRN  10010101100011000
NAM  NARW_ECOLI/3-159
ASQ  ILKVIGLLMEYPD--ELLWECKEDALALIR--R-----DAPMLTDFTHNLLNAPLLDKQAEWCEVFDRGRTTSLLLFEHVHAESRDRGQAMVDLLAEYEKVGLQLDCRELPDYLPLYLEYLSVLPDDQAKEGLLNVAPILALLGGRLKQREAPWYALFDALLQLAG
DSQ  ATCCTCAAAGTGATCGGCCTGTTGATGGAGTATCCGGAC------GAGCTGTTGTGGGAATGCAAGGAGGACGCGCTGGCGTTGATCCGC------CGC---------------GACGCGCCGATGCTTACGGATTTCACCCACAACCTGCTTAACGCGCCGCTGCTGGATAAACAGGCCGAATGGTGCGAAGTGTTTGACCGCGGGCGCACCACGTCGCTGCTGCTGTTCGAACATGTTCATGCCGAGTCCCGCGATCGCGGCCAGGCAATGGTGGACCTGCTGGCGGAGTATGAAAAGGTCGGCCTGCAGCTGGATTGTCGGGAACTGCCCGATTATCTACCGCTGTATCTGGAGTATTTAAGCGTACTGCCTGACGATCAGGCGAAAGAAGGATTGCTCAATGTTGCGCCGATCCTCGCCCTGCTTGGCGGTCGCTTAAAACAACGCGAGGCACCGTGGTACGCGTTGTTTGATGCTCTGCTGCAACTGGCGGGA
TRN  11011101101011010
NAM  NARJ_ECOLI/3-166
ASQ  ELVIVSRLLEYPD--AALWQHQQEMFEAIAASKNLPKEDAHALGIFLRDLTTMDPLDAQAQYSELFDRGRATSLLLFEHVHGESRDRGQAMVDLLAQYEQHGLQLNSRELPDHLPLYLEYLAQLPQSEAVEGLKDIAPILALLSARLQQRESRYAVLFDLLLKLAN
DSQ  GAACTCGTGATTGTATCGCGTCTCCTTGAATATCCGGAT------GCTGCCTTATGGCAGCATCAACAAGAGATGTTTGAGGCGATTGCCGCGTCGAAAAATCTGCCAAAAGAGGATGCCCATGCGCTGGGCATTTTCCTGCGCGATTTAACGACGATGGATCCGCTCGATGCCCAGGCGCAGTACAGCGAACTGTTCGACCGTGGCCGCGCCACGTCACTGTTGCTGTTTGAACATGTGCACGGCGAATCCCGCGACCGCGGCCAGGCGATGGTGGACCTGCTGGCGCAGTACGAGCAGCACGGCTTGCAGTTAAACAGCCGCGAATTGCCGGACCATCTGCCGCTGTATCTGGAGTACCTGGCGCAGCTGCCGCAAAGCGAAGCCGTGGAAGGTTTGAAAGATATCGCGCCGATTCTGGCATTGCTGAGCGCGCGTCTGCAACAGCGTGAAAGCCGTTATGCCGTGCTGTTTGATCTGCTGCTGAAACTGGCGAAT
TRN  11011101101011000
//