EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02604 - PhdYeFM)
FAM  PF02604
PID  PhdYeFM
DES  Phd_YefM
IPR  IPR003756
ANO  84
ALN  78
AID  0.181857
APH  ((((Q8PLK8_XANAC/10-84:1.08712,((((YAFN_ECOLI/7-76:0.93909,((Q88JZ5_PSEPK/7-79:0.47844,((((Q8GEI6_ERWPY/8-80:0.26904,Q9ZH43_MORMO/8-81:0.28849):0.15851,Q8ZPF8_SALTY/8-80:0.12734):0.28868,(Q60256_9ZZZZ/8-80:0.08228,Q7N4Q7_PHOLL/8-80:0.19517):0.21820):0.17370,(Q08800_VIBCH/8-80:0.35412,Q82UB1_NITEU/8-80:0.12586):0.11911):0.34211):0.04641,(Q9KMA1_VIBCH/14-86:0.22243,Q82UD0_NITEU/7-79:0.27589):0.26699):0.00000):0.50007,Q8RBG2_THETN/22-97:0.94660):0.53138,(Q8YUZ9_ANASP/1-76:1.55325,Q9X102_THEMA/6-78:1.02504):0.20807):0.19626,((Q8Y2S1_RALSO/6-78:0.84346,(Q826S3_STRAW/2-76:0.18190,Q9FCD0_STRCO/2-76:0.28196):0.82302):0.40335,((((Q7DCR7_VIBCH/1-68:0.57960,(Q8E847_SHEON/1-68:0.18195,Q7N5Y7_PHOLL/1-68:0.24936):0.22752):0.25042,(Q7N9R2_PHOLL/1-68:0.33162,Q82T18_NITEU/1-65:0.60010):0.13946):0.28516,((Q8D9P8_VIBVU/8-81:0.62588,(((Q8CLX8_VIBVU/1-74:0.15511,Q8PR83_XANAC/1-74:0.33889):0.40360,Q9RIC5_YERPE/1-69:0.69979):0.16590,(Q83DQ1_COXBU/5-78:0.29361,((Q7MYT0_PHOLL/5-78:0.18613,Q82WH3_NITEU/5-78:0.14996):0.18236,Q8GNE6_9PROT/6-79:0.49480):0.10515):0.36004):0.32339):0.31882,(O70047_9ZZZZ/7-74:0.21166,Q82UB6_NITEU/11-78:0.11610):0.66632):0.12888):0.09655,(((Q8UDV1_AGRT5/1-74:0.54201,((((Q99RM1_STAAM/1-74:0.42211,(Q7P2C4_FUSNV/1-71:0.57274,Q7P2Y6_FUSNV/1-74:0.25299):0.23444):0.08788,((Q8DNR2_STRR6/14-88:0.22175,Q8DX48_STRA5/1-75:0.20512):0.32453,Q83WJ8_ENTFC/1-75:0.34063):0.44823):0.05042,(((((Q88AP9_PSESM/1-74:0.17540,Q88IQ9_PSEPK/1-74:0.21130):0.23584,Q83AB4_COXBU/1-74:0.60936):0.03614,((Q87NP7_VIBPA/16-89:0.24555,Q8KPS5_SYNP7/17-90:0.17972):0.07305,Q82UX1_NITEU/17-91:0.29234):0.31635):0.11226,(((YEFM_ECOLI/1-74:0.22572,(Q7N280_PHOLL/1-74:0.33750,Q7N6B4_PHOLL/1-74:0.48946):0.04995):0.07269,((Y761_SYNY3/12-85:0.47601,(Q82WG6_NITEU/16-89:0.15587,Q9Z5W8_FRANO/1-75:0.46517):0.10434):0.14671,(Q8KRD6_RHOER/1-74:0.30376,Q8Z0C6_ANASP/19-92:0.56514):0.22738):0.02727):0.12176,Y2754_SYNY3/1-74:0.65841):0.03998):0.11668,Q7N4P2_PHOLL/1-74:0.63363):0.07545):0.00000,P73973_SYNY3/1-74:0.97258):0.12813):0.38290,((Q7PB29_RICSI/1-73:0.38153,Q7U8N8_SYNPX/1-73:0.42104):0.15783,Q99RH5_STAAM/1-75:0.85136):0.31797):0.15679,(O33347_MYCTU/1-74:0.52918,O50462_MYCTU/1-74:0.39540):0.15377):0.29294):0.10866):0.14995):0.58090):0.19647,((Q8R721_THETN/2-77:1.13962,(Q8F586_LEPIN/1-76:1.22839,Q8RAX6_THETN/1-75:1.44701):0.09141):0.27223,((((O07782_MYCTU/2-74:0.75242,P96916_MYCTU/1-74:0.82003):0.41474,Y3441_MYCBO/8-83:0.67524):0.00000,O50412_MYCTU/12-84:0.98386):0.21711,(((((Q87UE9_PSESM/1-69:0.40056,(Q92K09_RHIME/1-70:0.94471,Q9AH45_NEIME/1-74:0.49698):0.39302):0.45840,Q92SQ5_RHIME/1-72:0.57843):0.04180,((Q8Y121_RALSO/1-74:0.66947,(Q89SG5_BRAJA/14-86:0.55233,Q7NI03_GLOVI/2-75:0.37794):0.11510):0.07965,(Q7PA58_RICSI/1-74:1.17042,Q82T22_NITEU/1-74:0.79546):0.18045):0.76309):0.24480,(Q7NK01_GLOVI/1-75:0.35442,Q7NMY2_GLOVI/2-76:0.39024):0.28880):0.13617,Q92JV5_RHIME/2-77:1.28775):0.13464):0.38984):0.37657):0.77273,Q82VL3_NITEU/3-76:0.86694):0.87289,Y4EA_RHISN/5-75:0.25981,Q8KL67_RHIET/5-75:0.03192);
ATP  ((((Q8PLK8_XANAC/10-84,((((YAFN_ECOLI/7-76,((Q88JZ5_PSEPK/7-79,((((Q8GEI6_ERWPY/8-80,Q9ZH43_MORMO/8-81),Q8ZPF8_SALTY/8-80),(Q60256_9ZZZZ/8-80,Q7N4Q7_PHOLL/8-80)),(Q08800_VIBCH/8-80,Q82UB1_NITEU/8-80))),(Q9KMA1_VIBCH/14-86,Q82UD0_NITEU/7-79))),Q8RBG2_THETN/22-97),(Q8YUZ9_ANASP/1-76,Q9X102_THEMA/6-78)),((Q8Y2S1_RALSO/6-78,(Q826S3_STRAW/2-76,Q9FCD0_STRCO/2-76)),((((Q7DCR7_VIBCH/1-68,(Q8E847_SHEON/1-68,Q7N5Y7_PHOLL/1-68)),(Q7N9R2_PHOLL/1-68,Q82T18_NITEU/1-65)),((Q8D9P8_VIBVU/8-81,(((Q8CLX8_VIBVU/1-74,Q8PR83_XANAC/1-74),Q9RIC5_YERPE/1-69),(Q83DQ1_COXBU/5-78,((Q7MYT0_PHOLL/5-78,Q82WH3_NITEU/5-78),Q8GNE6_9PROT/6-79)))),(O70047_9ZZZZ/7-74,Q82UB6_NITEU/11-78))),(((Q8UDV1_AGRT5/1-74,((((Q99RM1_STAAM/1-74,(Q7P2C4_FUSNV/1-71,Q7P2Y6_FUSNV/1-74)),((Q8DNR2_STRR6/14-88,Q8DX48_STRA5/1-75),Q83WJ8_ENTFC/1-75)),(((((Q88AP9_PSESM/1-74,Q88IQ9_PSEPK/1-74),Q83AB4_COXBU/1-74),((Q87NP7_VIBPA/16-89,Q8KPS5_SYNP7/17-90),Q82UX1_NITEU/17-91)),(((YEFM_ECOLI/1-74,(Q7N280_PHOLL/1-74,Q7N6B4_PHOLL/1-74)),((Y761_SYNY3/12-85,(Q82WG6_NITEU/16-89,Q9Z5W8_FRANO/1-75)),(Q8KRD6_RHOER/1-74,Q8Z0C6_ANASP/19-92))),Y2754_SYNY3/1-74)),Q7N4P2_PHOLL/1-74)),P73973_SYNY3/1-74)),((Q7PB29_RICSI/1-73,Q7U8N8_SYNPX/1-73),Q99RH5_STAAM/1-75)),(O33347_MYCTU/1-74,O50462_MYCTU/1-74)))))),((Q8R721_THETN/2-77,(Q8F586_LEPIN/1-76,Q8RAX6_THETN/1-75)),((((O07782_MYCTU/2-74,P96916_MYCTU/1-74),Y3441_MYCBO/8-83),O50412_MYCTU/12-84),(((((Q87UE9_PSESM/1-69,(Q92K09_RHIME/1-70,Q9AH45_NEIME/1-74)),Q92SQ5_RHIME/1-72),((Q8Y121_RALSO/1-74,(Q89SG5_BRAJA/14-86,Q7NI03_GLOVI/2-75)),(Q7PA58_RICSI/1-74,Q82T22_NITEU/1-74))),(Q7NK01_GLOVI/1-75,Q7NMY2_GLOVI/2-76)),Q92JV5_RHIME/2-77)))),Q82VL3_NITEU/3-76),Y4EA_RHISN/5-75,Q8KL67_RHIET/5-75);
ATL  64.036
DNO  83
DLN  234
DID  0.348535
DPH  ((((((O33347_MYCTU/1-74:0.31277,(Q9X102_THEMA/6-78:0.67396,((Q8D9P8_VIBVU/8-81:0.50618,(O70047_9ZZZZ/7-74:0.30671,Q82UB6_NITEU/11-78:0.15976):0.24209):0.12224,((((Q8CLX8_VIBVU/1-74:0.17439,Q8PR83_XANAC/1-74:0.43161):0.26397,Q9RIC5_YERPE/1-69:0.45857):0.16168,((Q8GNE6_9PROT/6-79:0.32238,(Q7MYT0_PHOLL/5-78:0.23350,Q82WH3_NITEU/5-78:0.22588):0.11300):0.09347,Q83DQ1_COXBU/5-78:0.33182):0.08184):0.25626,((Q7N9R2_PHOLL/1-68:0.32924,((Q8E847_SHEON/1-68:0.21406,Q7N5Y7_PHOLL/1-68:0.21011):0.13010,(Q7DCR7_VIBCH/1-68:0.37371,Q82T18_NITEU/1-65:0.42567):0.12503):0.08211):0.19870,(((Q7PA58_RICSI/1-74:0.71596,(((Q8YUZ9_ANASP/1-76:0.66779,Q8RAX6_THETN/1-75:0.52098):0.01025,Q8R721_THETN/2-77:0.74791):0.11713,Q8F586_LEPIN/1-76:0.60945):0.09555):0.11169,(((((Q99RM1_STAAM/1-74:0.35525,((Q87NP7_VIBPA/16-89:0.17521,Q8KPS5_SYNP7/17-90:0.26558):0.16874,Q82UX1_NITEU/17-91:0.23210):0.19097):0.11753,(Y2754_SYNY3/1-74:0.41626,(((Q8Z0C6_ANASP/19-92:0.47726,(Q7N280_PHOLL/1-74:0.32804,Q7N6B4_PHOLL/1-74:0.34154):0.15231):0.04861,((Q7N4P2_PHOLL/1-74:0.36045,Q9Z5W8_FRANO/1-75:0.30811):0.14544,(Y761_SYNY3/12-85:0.36242,(((Q8KRD6_RHOER/1-74:0.34457,(Q88AP9_PSESM/1-74:0.23483,Q88IQ9_PSEPK/1-74:0.16886):0.24413):0.10093,Q82WG6_NITEU/16-89:0.17598):0.11628,(Q8UDV1_AGRT5/1-74:0.56879,Q83AB4_COXBU/1-74:0.30704):0.16264):0.13374):0.12842):0.05326):0.01734,P73973_SYNY3/1-74:0.62585):0.05628):0.03410):0.06566,((Q7PB29_RICSI/1-73:0.15999,Q7U8N8_SYNPX/1-73:0.58032):0.21583,Q99RH5_STAAM/1-75:0.38174):0.12130):0.05441,((Q8DNR2_STRR6/14-88:0.28208,Q8DX48_STRA5/1-75:0.18774):0.21011,Q83WJ8_ENTFC/1-75:0.31159):0.19208):0.05775,(Q7P2C4_FUSNV/1-71:0.28512,Q7P2Y6_FUSNV/1-74:0.19730):0.16555):0.07751):0.13624,((YAFN_ECOLI/7-76:0.59120,((((Q08800_VIBCH/8-80:0.18662,Q82UB1_NITEU/8-80:0.32877):0.18769,(Q8ZPF8_SALTY/8-80:0.20234,(Q8GEI6_ERWPY/8-80:0.32434,Q9ZH43_MORMO/8-81:0.28749):0.07619):0.11651):0.06083,(Q60256_9ZZZZ/8-80:0.19722,Q7N4Q7_PHOLL/8-80:0.18207):0.17059):0.16988,((Q9KMA1_VIBCH/14-86:0.26683,Q82UD0_NITEU/7-79:0.28409):0.12440,Q88JZ5_PSEPK/7-79:0.45375):0.07374):0.08696):0.32541,Q8RBG2_THETN/22-97:0.50505):0.25235):0.08878):0.08880):0.06269):0.25825):0.17742):0.07332,O50462_MYCTU/1-74:0.29523):0.20954,((Q8Y2S1_RALSO/6-78:0.51230,(Q826S3_STRAW/2-76:0.11547,Q9FCD0_STRCO/2-76:0.19020):0.36022):0.05560,((Q92JV5_RHIME/2-77:0.67421,(((Q8Y121_RALSO/1-74:0.38127,Q82T22_NITEU/1-74:0.63270):0.04085,Q7NI03_GLOVI/2-75:0.37454):0.16010,Q89SG5_BRAJA/14-86:0.30412):0.24182):0.09297,(((Q92K09_RHIME/1-70:0.48760,(Q87UE9_PSESM/1-69:0.27706,Q9AH45_NEIME/1-74:0.72697):0.16451):0.23430,((Q7NK01_GLOVI/1-75:0.30019,Q7NMY2_GLOVI/2-76:0.37130):0.13446,(Y3441_MYCBO/8-83:0.46955,((O50412_MYCTU/12-84:0.34972,O07782_MYCTU/2-74:0.56543):0.03662,P96916_MYCTU/1-74:0.44987):0.20976):0.16266):0.11744):0.08759,Q92SQ5_RHIME/1-72:0.42927):0.07149):0.14657):0.15202):0.32927,Q8PLK8_XANAC/10-84:0.59591):0.31730,Q82VL3_NITEU/3-76:0.58054):0.33498,Y4EA_RHISN/5-75:0.25852,Q8KL67_RHIET/5-75:0.12449);
DTP  ((((((O33347_MYCTU/1-74,(Q9X102_THEMA/6-78,((Q8D9P8_VIBVU/8-81,(O70047_9ZZZZ/7-74,Q82UB6_NITEU/11-78)),((((Q8CLX8_VIBVU/1-74,Q8PR83_XANAC/1-74),Q9RIC5_YERPE/1-69),((Q8GNE6_9PROT/6-79,(Q7MYT0_PHOLL/5-78,Q82WH3_NITEU/5-78)),Q83DQ1_COXBU/5-78)),((Q7N9R2_PHOLL/1-68,((Q8E847_SHEON/1-68,Q7N5Y7_PHOLL/1-68),(Q7DCR7_VIBCH/1-68,Q82T18_NITEU/1-65))),(((Q7PA58_RICSI/1-74,(((Q8YUZ9_ANASP/1-76,Q8RAX6_THETN/1-75),Q8R721_THETN/2-77),Q8F586_LEPIN/1-76)),(((((Q99RM1_STAAM/1-74,((Q87NP7_VIBPA/16-89,Q8KPS5_SYNP7/17-90),Q82UX1_NITEU/17-91)),(Y2754_SYNY3/1-74,(((Q8Z0C6_ANASP/19-92,(Q7N280_PHOLL/1-74,Q7N6B4_PHOLL/1-74)),((Q7N4P2_PHOLL/1-74,Q9Z5W8_FRANO/1-75),(Y761_SYNY3/12-85,(((Q8KRD6_RHOER/1-74,(Q88AP9_PSESM/1-74,Q88IQ9_PSEPK/1-74)),Q82WG6_NITEU/16-89),(Q8UDV1_AGRT5/1-74,Q83AB4_COXBU/1-74))))),P73973_SYNY3/1-74))),((Q7PB29_RICSI/1-73,Q7U8N8_SYNPX/1-73),Q99RH5_STAAM/1-75)),((Q8DNR2_STRR6/14-88,Q8DX48_STRA5/1-75),Q83WJ8_ENTFC/1-75)),(Q7P2C4_FUSNV/1-71,Q7P2Y6_FUSNV/1-74))),((YAFN_ECOLI/7-76,((((Q08800_VIBCH/8-80,Q82UB1_NITEU/8-80),(Q8ZPF8_SALTY/8-80,(Q8GEI6_ERWPY/8-80,Q9ZH43_MORMO/8-81))),(Q60256_9ZZZZ/8-80,Q7N4Q7_PHOLL/8-80)),((Q9KMA1_VIBCH/14-86,Q82UD0_NITEU/7-79),Q88JZ5_PSEPK/7-79))),Q8RBG2_THETN/22-97))))))),O50462_MYCTU/1-74),((Q8Y2S1_RALSO/6-78,(Q826S3_STRAW/2-76,Q9FCD0_STRCO/2-76)),((Q92JV5_RHIME/2-77,(((Q8Y121_RALSO/1-74,Q82T22_NITEU/1-74),Q7NI03_GLOVI/2-75),Q89SG5_BRAJA/14-86)),(((Q92K09_RHIME/1-70,(Q87UE9_PSESM/1-69,Q9AH45_NEIME/1-74)),((Q7NK01_GLOVI/1-75,Q7NMY2_GLOVI/2-76),(Y3441_MYCBO/8-83,((O50412_MYCTU/12-84,O07782_MYCTU/2-74),P96916_MYCTU/1-74)))),Q92SQ5_RHIME/1-72)))),Q8PLK8_XANAC/10-84),Q82VL3_NITEU/3-76),Y4EA_RHISN/5-75,Q8KL67_RHIET/5-75);
DTL  42.1375
RID  0.180167
RPH  (((((((Q8PLK8_XANAC/10-84:1.03296,((((YAFN_ECOLI/7-76:0.94735,((Q88JZ5_PSEPK/7-79:0.47669,((((Q8GEI6_ERWPY/8-80:0.26925,Q9ZH43_MORMO/8-81:0.28830):0.15803,Q8ZPF8_SALTY/8-80:0.12785):0.28845,(Q60256_9ZZZZ/8-80:0.08234,Q7N4Q7_PHOLL/8-80:0.19510):0.21842):0.17487,(Q08800_VIBCH/8-80:0.35506,Q82UB1_NITEU/8-80:0.12484):0.11806):0.34093):0.03337,(Q9KMA1_VIBCH/14-86:0.22306,Q82UD0_NITEU/7-79:0.27572):0.28094):0.00000):0.50924,Q8RBG2_THETN/22-97:0.93637):0.53006,(Q8YUZ9_ANASP/1-76:1.50805,Q9X102_THEMA/6-78:1.04175):0.20080):0.14478,((Q8Y2S1_RALSO/6-78:0.87207,(Q826S3_STRAW/2-76:0.18743,Q9FCD0_STRCO/2-76:0.27613):0.79970):0.43040,((((Q7DCR7_VIBCH/1-68:0.56806,(Q8E847_SHEON/1-68:0.19453,Q7N5Y7_PHOLL/1-68:0.23952):0.23290):0.25737,(Q7N9R2_PHOLL/1-68:0.35094,Q82T18_NITEU/1-65:0.57520):0.12161):0.29968,((Q8D9P8_VIBVU/8-81:0.60466,(O70047_9ZZZZ/7-74:0.23452,Q82UB6_NITEU/11-78:0.09384):0.54974):0.29597,(((Q8CLX8_VIBVU/1-74:0.15508,Q8PR83_XANAC/1-74:0.33843):0.39036,Q9RIC5_YERPE/1-69:0.70659):0.15089,(Q83DQ1_COXBU/5-78:0.28844,((Q7MYT0_PHOLL/5-78:0.18867,Q82WH3_NITEU/5-78:0.14686):0.18489,Q8GNE6_9PROT/6-79:0.49618):0.10519):0.37381):0.43941):0.19379):0.07587,(((((Q99RM1_STAAM/1-74:0.40698,(Q7P2C4_FUSNV/1-71:0.60674,Q7P2Y6_FUSNV/1-74:0.22042):0.24809):0.08809,((Q8UDV1_AGRT5/1-74:0.64924,((Q8DNR2_STRR6/14-88:0.21852,Q8DX48_STRA5/1-75:0.20999):0.32300,Q83WJ8_ENTFC/1-75:0.33713):0.39059):0.00255,P73973_SYNY3/1-74:1.00228):0.10375):0.06639,(((Q88AP9_PSESM/1-74:0.17864,Q88IQ9_PSEPK/1-74:0.21814):0.27349,(((Q7N280_PHOLL/1-74:0.30779,Q7N6B4_PHOLL/1-74:0.49123):0.10585,((Y761_SYNY3/12-85:0.48713,(Q82WG6_NITEU/16-89:0.08745,(Q7N4P2_PHOLL/1-74:0.48513,Q9Z5W8_FRANO/1-75:0.29437):0.22665):0.15486):0.12343,(Q8KRD6_RHOER/1-74:0.26581,Q8Z0C6_ANASP/19-92:0.58767):0.21771):0.03099):0.09331,Q83AB4_COXBU/1-74:0.58452):0.05222):0.06715,(Y2754_SYNY3/1-74:0.61864,((Q87NP7_VIBPA/16-89:0.24107,Q8KPS5_SYNP7/17-90:0.17963):0.09511,Q82UX1_NITEU/17-91:0.28212):0.29193):0.07527):0.11536):0.38781,((Q7PB29_RICSI/1-73:0.37751,Q7U8N8_SYNPX/1-73:0.43080):0.15808,Q99RH5_STAAM/1-75:0.84837):0.20711):0.25931,(O33347_MYCTU/1-74:0.51142,O50462_MYCTU/1-74:0.40552):0.12123):0.33356):0.09826):0.15926):0.59132):0.52643,(((O50412_MYCTU/12-84:0.99308,Y3441_MYCBO/8-83:0.65316):0.02048,(O07782_MYCTU/2-74:0.77336,P96916_MYCTU/1-74:0.79592):0.40524):0.19299,(((((Q87UE9_PSESM/1-69:0.39485,(Q92K09_RHIME/1-70:0.94370,Q9AH45_NEIME/1-74:0.49795):0.39936):0.45839,Q92SQ5_RHIME/1-72:0.57970):0.03600,((Q8Y121_RALSO/1-74:0.67182,(Q89SG5_BRAJA/14-86:0.55269,Q7NI03_GLOVI/2-75:0.37740):0.11394):0.08096,(Q7PA58_RICSI/1-74:1.16952,Q82T22_NITEU/1-74:0.79707):0.17938):0.76821):0.25575,(Q7NK01_GLOVI/1-75:0.35802,Q7NMY2_GLOVI/2-76:0.38563):0.27864):0.13356,Q92JV5_RHIME/2-77:1.31828):0.14280):0.27119):0.41895,Q8F586_LEPIN/1-76:1.26036):0.02740,Q8R721_THETN/2-77:1.17547):0.35333,Q8RAX6_THETN/1-75:1.21461):0.86485,Q82VL3_NITEU/3-76:0.51013):1.22668,Y4EA_RHISN/5-75:0.27122,Q8KL67_RHIET/5-75:0.02051);
RTP  (((((((Q8PLK8_XANAC/10-84,((((YAFN_ECOLI/7-76,((Q88JZ5_PSEPK/7-79,((((Q8GEI6_ERWPY/8-80,Q9ZH43_MORMO/8-81),Q8ZPF8_SALTY/8-80),(Q60256_9ZZZZ/8-80,Q7N4Q7_PHOLL/8-80)),(Q08800_VIBCH/8-80,Q82UB1_NITEU/8-80))),(Q9KMA1_VIBCH/14-86,Q82UD0_NITEU/7-79))),Q8RBG2_THETN/22-97),(Q8YUZ9_ANASP/1-76,Q9X102_THEMA/6-78)),((Q8Y2S1_RALSO/6-78,(Q826S3_STRAW/2-76,Q9FCD0_STRCO/2-76)),((((Q7DCR7_VIBCH/1-68,(Q8E847_SHEON/1-68,Q7N5Y7_PHOLL/1-68)),(Q7N9R2_PHOLL/1-68,Q82T18_NITEU/1-65)),((Q8D9P8_VIBVU/8-81,(O70047_9ZZZZ/7-74,Q82UB6_NITEU/11-78)),(((Q8CLX8_VIBVU/1-74,Q8PR83_XANAC/1-74),Q9RIC5_YERPE/1-69),(Q83DQ1_COXBU/5-78,((Q7MYT0_PHOLL/5-78,Q82WH3_NITEU/5-78),Q8GNE6_9PROT/6-79))))),(((((Q99RM1_STAAM/1-74,(Q7P2C4_FUSNV/1-71,Q7P2Y6_FUSNV/1-74)),((Q8UDV1_AGRT5/1-74,((Q8DNR2_STRR6/14-88,Q8DX48_STRA5/1-75),Q83WJ8_ENTFC/1-75)),P73973_SYNY3/1-74)),(((Q88AP9_PSESM/1-74,Q88IQ9_PSEPK/1-74),(((Q7N280_PHOLL/1-74,Q7N6B4_PHOLL/1-74),((Y761_SYNY3/12-85,(Q82WG6_NITEU/16-89,(Q7N4P2_PHOLL/1-74,Q9Z5W8_FRANO/1-75))),(Q8KRD6_RHOER/1-74,Q8Z0C6_ANASP/19-92))),Q83AB4_COXBU/1-74)),(Y2754_SYNY3/1-74,((Q87NP7_VIBPA/16-89,Q8KPS5_SYNP7/17-90),Q82UX1_NITEU/17-91)))),((Q7PB29_RICSI/1-73,Q7U8N8_SYNPX/1-73),Q99RH5_STAAM/1-75)),(O33347_MYCTU/1-74,O50462_MYCTU/1-74)))))),(((O50412_MYCTU/12-84,Y3441_MYCBO/8-83),(O07782_MYCTU/2-74,P96916_MYCTU/1-74)),(((((Q87UE9_PSESM/1-69,(Q92K09_RHIME/1-70,Q9AH45_NEIME/1-74)),Q92SQ5_RHIME/1-72),((Q8Y121_RALSO/1-74,(Q89SG5_BRAJA/14-86,Q7NI03_GLOVI/2-75)),(Q7PA58_RICSI/1-74,Q82T22_NITEU/1-74))),(Q7NK01_GLOVI/1-75,Q7NMY2_GLOVI/2-76)),Q92JV5_RHIME/2-77))),Q8F586_LEPIN/1-76),Q8R721_THETN/2-77),Q8RAX6_THETN/1-75),Q82VL3_NITEU/3-76),Y4EA_RHISN/5-75,Q8KL67_RHIET/5-75);
RTL  63.7945
LNK  O07782_MYCTU/2-74:O07782:BX842574
LNK  O33347_MYCTU/1-74:O33347:BX842581
LNK  O50412_MYCTU/12-84:O50412:BX842582
LNK  O50462_MYCTU/1-74:O50462:BX842576
LNK  O70047_9ZZZZ/7-74:O70047:AF047479
LNK  P73973_SYNY3/1-74:P73973:BA000022
LNK  P96916_MYCTU/1-74:P96916:BX842574
LNK  Q08800_VIBCH/8-80:Q08800:X64097
LNK  Q60256_9ZZZZ/8-80:Q60256:M26308
LNK  Q7DCR7_VIBCH/1-68:Q7DCR7:AE004370
LNK  Q7MYT0_PHOLL/5-78:Q7MYT0:BX571874
LNK  Q7N280_PHOLL/1-74:Q7N280:BX571869
LNK  Q7N4P2_PHOLL/1-74:Q7N4P2:BX571866
LNK  Q7N4Q7_PHOLL/8-80:Q7N4Q7:BX571866
LNK  Q7N5Y7_PHOLL/1-68:Q7N5Y7:BX571865
LNK  Q7N6B4_PHOLL/1-74:Q7N6B4:BX571864
LNK  Q7N9R2_PHOLL/1-68:Q7N9R2:BX571859
LNK  Q7NI03_GLOVI/2-75:Q7NI03:BA000045
LNK  Q7NK01_GLOVI/1-75:Q7NK01:BA000045
LNK  Q7NMY2_GLOVI/2-76:Q7NMY2:BA000045
LNK  Q7P2C4_FUSNV/1-71:Q7P2C4:AABF01000142
LNK  Q7P2Y6_FUSNV/1-74:Q7P2Y6:AABF01000018
LNK  Q7PA58_RICSI/1-74:Q7PA58:AABW01000001
LNK  Q7PB29_RICSI/1-73:Q7PB29:AABW01000001
LNK  Q7U8N8_SYNPX/1-73:Q7U8N8:BX569690
LNK  Q826S3_STRAW/2-76:Q826S3:BA000030
LNK  Q82T18_NITEU/1-65:Q82T18:BX321863
LNK  Q82T22_NITEU/1-74:Q82T22:BX321863
LNK  Q82UB1_NITEU/8-80:Q82UB1:BX321861
LNK  Q82UB6_NITEU/11-78:Q82UB6:BX321861
LNK  Q82UD0_NITEU/7-79:Q82UD0:BX321861
LNK  Q82UX1_NITEU/17-91:Q82UX1:BX321860
LNK  Q82VL3_NITEU/3-76:Q82VL3:BX321859
LNK  Q82WG6_NITEU/16-89:Q82WG6:BX321858
LNK  Q82WH3_NITEU/5-78:Q82WH3:BX321858
LNK  Q83AB4_COXBU/1-74:Q83AB4:AE016966
LNK  Q83DQ1_COXBU/5-78:Q83DQ1:AE016961
LNK  Q83WJ8_ENTFC/1-75:Q83WJ8:AF507977
LNK  Q87NP7_VIBPA/16-89:Q87NP7:BA000031
LNK  Q87UE9_PSESM/1-69:Q87UE9:AE016875
LNK  Q88AP9_PSESM/1-74:Q88AP9:AE016857
LNK  Q88IQ9_PSEPK/1-74:Q88IQ9:AE016785
LNK  Q88JZ5_PSEPK/7-79:Q88JZ5:AE016783
LNK  Q89SG5_BRAJA/14-86:Q89SG5:BA000040
LNK  Q8CLX8_VIBVU/1-74:Q8CLX8:AE016805
LNK  Q8D9P8_VIBVU/8-81:Q8D9P8:AE016805
LNK  Q8DNR2_STRR6/14-88:Q8DNR2:AE008526
LNK  Q8DX48_STRA5/1-75:Q8DX48:AE014282
LNK  Q8E847_SHEON/1-68:Q8E847:AE015915
LNK  Q8F586_LEPIN/1-76:Q8F586:AE011355
LNK  Q8GEI6_ERWPY/8-80:Q8GEI6:AY123045
LNK  Q8GNE6_9PROT/6-79:Q8GNE6:AF529421
LNK  Q8KL67_RHIET/5-75:Q8KL67:U80928
LNK  Q8KPS5_SYNP7/17-90:Q8KPS5:AY120853
LNK  Q8KRD6_RHOER/1-74:Q8KRD6:AY026386
LNK  Q8PLK8_XANAC/10-84:Q8PLK8:AE011811
LNK  Q8PR83_XANAC/1-74:Q8PR83:AE011631
LNK  Q8R721_THETN/2-77:Q8R721:AE013201
LNK  Q8RAX6_THETN/1-75:Q8RAX6:AE013070
LNK  Q8RBG2_THETN/22-97:Q8RBG2:AE013052
LNK  Q8UDV1_AGRT5/1-74:Q8UDV1:AE009153
LNK  Q8Y121_RALSO/1-74:Q8Y121:AL646061
LNK  Q8Y2S1_RALSO/6-78:Q8Y2S1:AL646058
LNK  Q8YUZ9_ANASP/1-76:Q8YUZ9:BA000019
LNK  Q8Z0C6_ANASP/19-92:Q8Z0C6:BA000019
LNK  Q8ZPF8_SALTY/8-80:Q8ZPF8:AE008767
LNK  Q92JV5_RHIME/2-77:Q92JV5:AL591792
LNK  Q92K09_RHIME/1-70:Q92K09:AL591790
LNK  Q92SQ5_RHIME/1-72:Q92SQ5:AL591783
LNK  Q99RH5_STAAM/1-75:Q99RH5:BA000017
LNK  Q99RM1_STAAM/1-74:Q99RM1:BA000017
LNK  Q9AH45_NEIME/1-74:Q9AH45:AF319535
LNK  Q9FCD0_STRCO/2-76:Q9FCD0:AL939108
LNK  Q9KMA1_VIBCH/14-86:Q9KMA1:AE004379
LNK  Q9RIC5_YERPE/1-69:Q9RIC5:AL117211
LNK  Q9X102_THEMA/6-78:Q9X102:AE001783
LNK  Q9Z5W8_FRANO/1-75:Q9Z5W8:AF121418
LNK  Q9ZH43_MORMO/8-81:Q9ZH43:AF072126
LNK  Y2754_SYNY3/1-74:P58235:D90914
LNK  Y3441_MYCBO/8-83:P65078:BX248346
LNK  Y4EA_RHISN/5-75:P55424:AE000070
LNK  Y761_SYNY3/12-85:P58236:D90914
LNK  YAFN_ECOLI/7-76:Q47156:D38582
LNK  YEFM_ECOLI/1-74:P46147:
AMK  xxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q83WJ8_ENTFC/1-75
ASQ  MEAVAYSNF.RQNLRSYMKQVNEDAETLIVTSKDVEDTVVVLSKRDYDSMQE-TLRTLSNNYVMEKIRR.GDEQFSKG
DSQ  ATGGAAGCAGTAGCTTATTCAAATTTC...CGCCAAAATTTACGTAGTTATATGAAACAAGTTAATGAGGATGCTGAAACACTTATTGTAACAAGTAAAGATGTAGAAGATACAGTTGTTGTATTATCAAAAAGAGATTATGATTCTATGCAAGAA---ACGTTGAGAACACTTTCTAATAATTACGTCATGGAAAAAATTCGTCGA...GGAGATGAACAATTCTCCAAAGGT
TRN  10010101110011000
NAM  Q8DX48_STRA5/1-75
ASQ  MEAIVYSHF.RNNLKDYMKKVNDEFEPLIVVNKNPDENIVVLSQDSWESLQE-TIRLMENDYLSHKVIN.GISQVKEK
DSQ  ATGGAGGCTATTGTTTATTCACATTTT...AGAAATAATTTAAAAGATTATATGAAGAAGGTCAATGATGAATTTGAGCCTTTGATTGTAGTTAATAAAAATCCTGATGAAAATATAGTGGTTTTATCTCAAGATAGCTGGGAAAGTTTACAAGAA---ACGATTCGTTTGATGGAAAATGATTATCTATCACATAAGGTTATTAAT...GGTATATCACAAGTTAAAGAGAAG
TRN  10010101110011000
NAM  Q8DNR2_STRR6/14-88
ASQ  MEAVLYSTF.RNHLKDYMKKVNDEFEPLTVVNKNPDEDIVVLSKSEWDSIQE-TLRIAQNKELSDKVLR.GMAQVRAG
DSQ  ATGGAAGCAGTCCTTTACTCAACATTC...CGAAATCATTTAAAGGACTACATGAAGAAGGTAAATGATGAATTTGAGCCTTTGACGGTGGTCAATAAAAATCCAGATGAGGACATTGTAGTTCTTTCAAAGAGCGAATGGGACAGTATTCAGGAA---ACCCTGAGAATCGCCCAAAATAAGGAGTTATCAGACAAGGTTTTACGA...GGAATGGCTCAAGTCCGTGCTGGA
TRN  10010101100011000
NAM  Q7P2Y6_FUSNV/1-74
ASQ  MIATNYSEV.RNNLKAYCDKATKDYETIIITRKNNE-NVVLMSEEEYNNLME-NLYIRSNLKYYQRLVE.SIKEVEKG
DSQ  ATGATAGCAACAAATTATTCAGAGGTT...AGAAATAATTTAAAAGCTTATTGTGATAAGGCAACAAAAGACTACGAAACTATAATTATTACAAGAAAAAATAATGAA---AATGTTGTTCTGATGAGTGAAGAAGAATACAATAATCTTATGGAA---AACCTTTATATAAGATCAAATCTTAAATATTATCAAAGACTTGTAGAA...AGTATAAAAGAAGTTGAAAAGGGT
TRN  10010101100011000
NAM  Q7P2C4_FUSNV/1-71
ASQ  MLAINYTTL.RTNLKSYFDKAVDNDEDIIITRKNER-NVVLLSLDKYNEFLK----AMRNLEYMTKIRE.GIAELEAG
DSQ  ATGTTAGCAATTAATTATACAACTTTG...AGAACCAATTTAAAAAGCTATTTTGATAAAGCAGTAGATAATGATGAAGATATAATTATAACAAGAAAAAATGAAAGA---AATGTTGTTCTATTAAGTCTTGATAAATACAATGAGTTTTTAAAA------------GCTATGAGAAATCTTGAATATATGACAAAAATAAGAGAA...GGAATAGCTGAATTAGAGGCAGGA
TRN  10010101110011010
NAM  Q9Z5W8_FRANO/1-75
ASQ  MQTVNYSTF.RNELSDSMDRVTKNHSPMIVTRGSKKEAVVMMSLEDFKAYEE-TAYLMRSMNNYKRLQN.SIDEVESG
DSQ  ATGCAAACCGTTAATTATTCAACTTTT...AGAAATGAACTATCTGATTCAATGGATAGAGTAACAAAAAATCATAGTCCTATGATTGTAACTAGAGGTTCAAAAAAAGAAGCAGTTGTTATGATGTCGTTAGAGGATTTTAAAGCTTATGAAGAA---ACAGCCTATCTTATGAGAAGCATGAACAACTATAAGAGACTACAAAAT...TCTATTGATGAAGTAGAATCTGGT
TRN  10010101110011000
NAM  Q82WG6_NITEU/16-89
ASQ  MDAITYSTA.RAKLADTMNRVCDNHEPIIITRNGEQ-SVVMMSLDDFKALEE-TSYLLRSPKNAKRLLE.SIAALESG
DSQ  ATGGACGCTATCACTTACAGCACTGCC...AGAGCCAAACTTGCCGACACCATGAACCGCGTTTGCGATAACCATGAACCTATCATAATCACACGCAACGGAGAACAA---TCCGTTGTAATGATGTCGCTCGACGACTTCAAGGCGCTGGAGGAA---ACCTCTTACCTGCTCCGTAGCCCAAAGAATGCGAAGCGGCTGCTGGAA...AGCATCGCAGCTCTTGAATCAGGC
TRN  10010101100011001
NAM  Q7N4P2_PHOLL/1-74
ASQ  MDTINYSAF.RTHFASPLDKVNDNHKPILITHQNGK-PAIALRLEDFQAYEE-TAYLMASPKNAAHLNQ.AIAEVEAG
DSQ  ATGGACACAATAAACTATTCAGCATTT...AGAACTCACTTCGCCAGCCCCTTAGATAAAGTGAACGACAATCACAAGCCAATTCTGATTACTCATCAGAATGGCAAG---CCAGCGATCGCCCTACGTTTGGAAGATTTTCAAGCCTACGAAGAA---ACAGCCTATTTAATGGCTAGCCCGAAAAACGCGGCACATTTAAATCAG...GCAATTGCTGAAGTGGAAGCAGGG
TRN  10010101100011000
NAM  Q7N6B4_PHOLL/1-74
ASQ  MRKTIYSVA.KGNLASIMDQVVQDCTPILITRQNGG-DCVIISSAEYASLEE-TAYLLRSSANAKHLLK.SLEQVNSG
DSQ  ATGCGGAAGACAATATATAGCGTTGCA...AAGGGAAATCTTGCTTCGATAATGGATCAAGTTGTTCAGGATTGTACACCAATATTGATTACCAGACAAAACGGCGGT---GATTGCGTTATTATTTCAAGTGCAGAATATGCAAGCCTTGAAGAA---ACTGCTTATTTACTACGTTCATCCGCTAATGCAAAACATTTACTTAAA...TCATTGGAGCAGGTAAATAGCGGA
TRN  10010101110011000
NAM  YEFM_ECOLI/1-74
ASQ  MRTISYSEA.RQNLSATMMKAVEDHAPILITRQNGE-ACVLMSLEEYNSLEE-TAYLLRSPANARRLMD.SIDSLKSG
NAM  Q7N280_PHOLL/1-74
ASQ  MKVLTYSEA.KQNLSETMTNVVNDCSPVIITRKNGE-SCILMSLTDVESLQE-TAYLMRSPTNANRLLE.STSQLRTR
DSQ  ATGAAAGTGTTAACTTACTCAGAAGCA...AAACAAAATCTTTCTGAAACGATGACAAATGTCGTGAACGATTGTAGCCCAGTGATTATCACTCGTAAAAATGGCGAA---AGTTGCATACTTATGTCATTAACTGATGTCGAATCTTTGCAAGAA---ACAGCTTATTTGATGAGATCACCAACCAACGCGAATCGTCTTCTGGAA...TCTACCTCTCAGTTAAGAACCAGA
TRN  10010101100011000
NAM  Y761_SYNY3/12-85
ASQ  MNAVSQIIA.QQKLAAIMEQVCSDHVPTIITRDTQP-SVVMISLEDYQSLEE-TAYLLRSPNNAQKLMS.AIKQLEND
DSQ  ATGAACGCAGTCAGCCAAATTATTGCA...CAACAAAAACTTGCAGCTATCATGGAGCAAGTATGTAGTGATCATGTTCCAACAATTATCACCAGGGATACCCAACCA---TCTGTCGTCATGATTTCCCTGGAAGACTATCAGTCATTAGAAGAA---ACAGCATATCTACTACGTAGCCCGAACAATGCTCAAAAATTGATGTCG...GCGATCAAGCAATTAGAAAATGAT
TRN  10010101100011000
NAM  Q83AB4_COXBU/1-74
ASQ  MNVVTFSEL.RAQLKKILDLSADQHEPVVVKRPNKE-TMVILSLRDFEALKE-TAYLLSNEANAARLRQ.SIRSLKQG
DSQ  ATGAACGTAGTTACTTTTAGCGAACTC...AGGGCGCAACTTAAAAAAATCTTGGATCTTTCCGCCGATCAACACGAACCTGTCGTCGTTAAACGGCCAAATAAAGAA---ACCATGGTCATTTTATCTTTACGCGACTTTGAGGCTCTAAAAGAA---ACAGCTTATCTCTTAAGTAACGAAGCTAATGCGGCCCGTCTTCGTCAG...TCTATCCGCAGCTTAAAACAAGGC
TRN  10010101110011010
NAM  Q82UX1_NITEU/17-91
ASQ  MKVVTYSHA.RNALKSILDDVIQDADVIVISRRDAEGDAVVMSLDSYNSIME-TLHLTSNPANAAALAK.AIAQDKAG
DSQ  ATGAAGGTTGTTACTTATTCGCATGCG...CGTAATGCGTTAAAGTCTATTTTGGATGATGTCATTCAGGATGCTGATGTAATTGTTATTAGTCGTCGCGATGCAGAAGGTGATGCTGTGGTGATGTCGCTGGATAGCTATAACAGCATCATGGAA---ACATTGCACTTAACCAGTAATCCAGCAAATGCCGCAGCCTTAGCCAAG...GCAATTGCTCAGGATAAGGCAGGA
TRN  11011111101111110
NAM  Q8KPS5_SYNP7/17-90
ASQ  MKVVSFSDA.RKNLKTVLDEVVNDADYTIITRRNAE-EVVVMSLDSFNSLIE-TFHLLKSPANAAHLQR.SIAQYQQG
DSQ  ATGAAAGTTGTTTCCTTCAGTGACGCC...AGAAAAAATCTCAAGACTGTCTTGGATGAAGTCGTCAACGACGCTGACTACACGATCATTACTCGCCGCAATGCCGAG---GAAGTCGTGGTCATGTCCCTCGACTCCTTCAATAGCCTGATCGAA---ACCTTCCACCTGCTCAAATCCCCTGCCAATGCTGCTCACCTACAACGC...TCGATCGCTCAGTACCAGCAAGGT
TRN  10010101100011011
NAM  Q87NP7_VIBPA/16-89
ASQ  MRIVSFTEA.RNGLKAVLDGVVNDADTTVITRRDSE-DAVVMSLDYYNSLME-TVHLLRSPQNVEHLNR.SIAQYRAG
DSQ  ATGAGAATCGTATCTTTTACTGAAGCT...AGAAATGGTCTCAAAGCTGTTTTAGACGGTGTAGTTAATGATGCTGATACAACAGTTATTACACGCCGTGATTCTGAG---GATGCAGTGGTTATGTCTTTAGACTACTACAATAGCCTTATGGAG---ACTGTTCATTTACTACGCTCTCCTCAAAACGTTGAACACCTAAACCGT...TCGATAGCACAGTACCGCGCTGGT
TRN  10010101110011010
NAM  Q88IQ9_PSEPK/1-74
ASQ  MHVLTFSQA.RAELKQTMDDVCRDHEPAVITRQRGE-PVVMMSLEDYNGMNE-TIHLLGSSKNASRLRS.SIAQLRDG
DSQ  ATGCACGTACTGACTTTTAGCCAGGCT...CGCGCCGAACTGAAGCAGACAATGGATGATGTTTGCCGGGACCATGAGCCCGCCGTAATCACGCGACAGCGTGGCGAA---CCCGTAGTGATGATGTCTCTGGAGGACTACAACGGGATGAACGAG---ACCATTCACCTGTTGGGATCGTCCAAAAACGCTTCGCGCTTGCGCTCA...TCCATCGCTCAGCTCCGGGACGGC
TRN  11011101101011001
NAM  Q88AP9_PSESM/1-74
ASQ  MQVLSFSQA.RAGLKQAMDDVCRDHEPALITRLRGD-HVVMLSLDDYNSMSE-TMYLLGTEANAKHLRQ.SIAQHKAG
DSQ  ATGCAGGTTTTATCATTCAGCCAGGCT...CGCGCCGGTTTAAAGCAAGCGATGGATGATGTGTGCCGGGACCATGAGCCAGCACTCATCACACGCCTGCGCGGTGAT---CATGTAGTCATGCTTTCCCTTGATGACTACAACTCGATGTCAGAA---ACCATGTACCTGCTAGGCACAGAGGCCAATGCGAAGCACCTGCGGCAA...TCCATTGCGCAGCACAAAGCCGGA
TRN  11011101101011000
NAM  Q99RM1_STAAM/1-74
ASQ  MIIKNYSYA.RQNLKALMTKVNDDSDMVTVTSTDDK-NVVIMSESDYNSMME-TLYLQQNPNNAEHLAQ.SIADLERG
DSQ  ATGATTATTAAAAATTATTCATACGCT...CGACAGAATTTAAAGGCACTTATGACAAAAGTAAATGATGATAGTGATATGGTAACTGTAACATCTACTGATGATAAA---AACGTAGTAATCATGTCAGAATCAGATTATAACTCCATGATGGAA---ACACTTTACCTCCAACAGAACCCAAATAATGCTGAACACTTAGCTCAA...TCAATTGCAGATCTAGAACGTGGG
TRN  11011101111011000
NAM  Q8Z0C6_ANASP/19-92
ASQ  SNTYTYTQA.RDRLSELCDKVTSERDFVVITRRNAE-NVALIPVDELSSLLE-TAHLLRSPRNAERLLR.ALDRAKSG
DSQ  TCTAACACTTACACTTACACACAAGCA...CGAGATCGTTTGTCTGAATTATGCGACAAGGTTACTTCAGAACGTGATTTTGTAGTTATTACACGTCGGAATGCTGAA---AATGTCGCTTTAATACCTGTTGACGAGCTTTCGAGTCTTTTAGAA---ACTGCTCATCTTTTACGTTCCCCACGTAACGCTGAACGTTTGCTAAGG...GCTTTAGATAGAGCTAAATCAGGT
TRN  10010101110011000
NAM  Q8KRD6_RHOER/1-74
ASQ  MKTMSYTES.RARYAEVLDGVTNDREEVIITRAGHE-PVVMVSLDDYESLRE-TAHLMRSPANARRLLD.AMERLESG
DSQ  ATGAAAACCATGAGCTACACCGAGTCC...CGGGCCCGCTACGCCGAGGTCCTCGACGGGGTCACCAACGACCGCGAAGAGGTCATCATCACCCGCGCCGGCCACGAA---CCGGTGGTGATGGTCTCCCTCGACGACTACGAGTCCCTGCGCGAG---ACCGCTCACCTGATGCGATCGCCGGCCAATGCACGACGTCTGCTCGAT...GCCATGGAACGGCTCGAGTCCGGC
TRN  11011101101011011
NAM  Y2754_SYNY3/1-74
ASQ  MKAITTTQA.KDHLDELINAVISDLEPTIVSNNQGQ-QAVLISLDEFNSWQE-TLYLLSNPTNAEHLMA.SIKQAETG
DSQ  ATGAAAGCAATTACAACCACCCAAGCC...AAAGATCATTTGGATGAATTAATTAATGCTGTCATTTCTGATCTAGAACCAACCATCGTTAGCAACAATCAAGGTCAG---CAGGCGGTATTAATATCATTGGATGAATTTAATTCTTGGCAAGAA---ACCCTTTACTTACTCTCTAATCCAACCAACGCAGAACATTTAATGGCA...TCGATTAAGCAAGCTGAAACTGGA
TRN  10010101110011000
NAM  Q8UDV1_AGRT5/1-74
ASQ  MANVRFTEF.RQNFATHFDRVLETRAPLLVTRQGKE-AVVVLAEGEYESMQE-TLHLLSNPANASRLRA.SMGELERG
DSQ  ATGGCGAATGTGCGATTTACCGAGTTC...AGGCAGAACTTCGCGACCCATTTCGACCGGGTTCTGGAAACCCGCGCGCCATTGCTCGTCACGCGGCAAGGCAAAGAG---GCGGTCGTGGTGCTTGCCGAAGGAGAATATGAGAGCATGCAGGAA---ACGCTGCATCTCCTGTCCAACCCGGCAAATGCCTCAAGGCTTCGCGCG...TCCATGGGCGAACTTGAGCGCGGT
TRN  10010101100011001
NAM  P73973_SYNY3/1-74
ASQ  METINYQQF.SEKLPTLVEKIGNEQEPLCLELPNYL-RAVIISEQDYRSLME-TVYLLSNPVNAEKLLT.TASRSIDQ
DSQ  ATGGAAACCATTAATTATCAACAATTC...TCTGAAAAACTGCCCACTTTGGTAGAAAAAATAGGTAATGAGCAAGAACCTCTCTGTCTAGAGCTTCCGAATTATTTA---CGAGCTGTTATTATATCTGAGCAAGATTACCGTAGTTTGATGGAA---ACTGTTTATCTGTTGAGTAACCCTGTTAATGCTGAAAAGTTATTAACT...ACCGCTAGTCGATCAATTGATCAA
TRN  10010101100011000
NAM  Q99RH5_STAAM/1-75
ASQ  MIITSPTEA.RKDFYQLLKNVNNNHEPIYISGNNAENNAVIIGLEDWKSIQE-TIYLESTGTMDKVRER.EKDNSGTT
DSQ  ATGATTATCACTAGTCCTACAGAAGCG...AGAAAAGATTTTTATCAATTACTAAAAAATGTTAATAATAATCACGAACCAATTTATATTAGTGGCAATAATGCCGAAAATAATGCTGTGATTATAGGTTTAGAAGATTGGAAAAGTATACAAGAG---ACAATATATCTTGAATCTACTGGTACAATGGACAAAGTAAGAGAAAGA...GAAAAAGATAATAGTGGTACAACA
TRN  10010101110011010
NAM  Q7U8N8_SYNPX/1-73
ASQ  MASISVTEA.RKRLFALVDEVADSHTPVEIHGKRS--NAVLVSEDDWRAIQE-TLYLAAIPGMRESIVD.GMATPTSD
DSQ  ATGGCATCGATTTCCGTAACCGAGGCG...CGCAAACGCTTGTTTGCCTTGGTGGATGAAGTGGCTGATTCACATACACCAGTCGAAATCCACGGCAAACGCAGC------AATGCCGTGCTGGTGTCGGAAGACGATTGGCGCGCGATTCAAGAA---ACGCTGTATCTCGCGGCAATACCAGGGATGCGGGAGTCGATTGTCGAC...GGAATGGCAACGCCAACAAGCGAC
TRN  10010101100011001
NAM  Q7PB29_RICSI/1-73
ASQ  MEIYNTSEA.RSKLYKLIDYVSDVHKPVYIKGKRN--NVVIISEEDYRNMEE-TLYLLSIPNMHKSIIE.GRAEPIAK
DSQ  ATGGAAATATATAATACAAGCGAAGCA...AGAAGTAAGCTTTATAAACTTATAGATTATGTTTCTGATGTACACAAACCTGTTTATATTAAAGGTAAAAGAAAT------AATGTAGTTATAATTTCAGAAGAAGATTATCGTAATATGGAAGAA---ACTTTATATTTATTATCTATTCCAAATATGCATAAGTCTATAATTGAA...GGACGAGCAGAGCCTATAGCAAAG
TRN  10010101110011000
NAM  O50462_MYCTU/1-74
ASQ  MAVVPLGEV.RNRLSEYVAEVELTHERITITRHGHP-AAVLISADDLASIEE-TLEVLRTPGASEAIRE.GLADVAAG
DSQ  ATGGCTGTTGTCCCACTGGGCGAAGTC...CGCAATCGCCTCTCTGAGTACGTCGCCGAAGTTGAGCTGACACACGAGCGCATCACGATAACCCGGCACGGTCATCCG---GCGGCGGTATTGATCTCGGCCGATGACCTGGCGTCCATCGAGGAA---ACGCTGGAGGTGCTACGCACCCCTGGCGCCAGCGAGGCCATTCGTGAA...GGCCTCGCCGATGTTGCCGCAGGG
TRN  10010111100111011
NAM  O33347_MYCTU/1-74
ASQ  MRILPISTI.KGKLNEFVDAVSSTQDQITITKNGAP-AAVLVGADEWESLQE-TLYWLAQPGIRESIAE.ADADIASG
DSQ  ATGCGGATACTGCCGATTTCGACGATC...AAGGGCAAGCTCAATGAGTTCGTCGACGCGGTCTCGTCGACACAGGACCAGATCACCATCACCAAGAACGGTGCACCC---GCAGCCGTTCTGGTCGGCGCCGACGAGTGGGAATCGTTGCAGGAG---ACGCTGTACTGGCTGGCGCAACCCGGAATCAGGGAGTCGATCGCTGAA...GCCGACGCCGACATTGCCTCCGGC
TRN  10010101100011011
NAM  Q83DQ1_COXBU/5-78
ASQ  CRVKPISYL.KSNTAEIVRDISETREPMLITQNGEA-KLVVLDVKSYEEYEE-TLSLLKILSLGQKEIE.KGQFRSAD
DSQ  TGCCGCGTAAAACCAATTTCTTATCTC...AAAAGCAATACCGCTGAAATCGTCCGCGATATTTCTGAAACTCGAGAACCGATGCTGATTACTCAAAACGGTGAAGCG---AAACTCGTTGTTTTAGACGTAAAATCCTATGAAGAATATGAAGAA---ACTTTGTCTCTTCTTAAGATCCTATCCTTAGGACAGAAAGAAATTGAA...AAGGGTCAATTTCGTTCTGCCGAC
TRN  11011101101011010
NAM  Q82WH3_NITEU/5-78
ASQ  TQIRPISYL.KANAAEVLAYLTENREPLIITQNGEA-KAVIQDIASFEETQE-TLALLKILALGNAEIE.AGEVQPVH
DSQ  ACACAGATCAGACCTATTAGTTATCTA...AAAGCAAATGCCGCTGAGGTTTTAGCTTATTTAACCGAAAACAGGGAACCATTGATCATTACTCAGAATGGAGAAGCT---AAAGCTGTTATCCAGGATATCGCCTCTTTTGAAGAGACACAGGAA---ACGTTAGCATTGCTAAAAATTCTTGCACTCGGCAATGCTGAGATCGAA...GCGGGTGAAGTGCAGCCGGTACAT
TRN  10010101110011010
NAM  Q7MYT0_PHOLL/5-78
ASQ  EQIKPISYL.KANAATVMTTLAESRSPMIITQNGEA-KAVIQDIASYEQTQE-TIALLKILALGQQQVK.AGEVTPVK
DSQ  GAACAGATCAAACCCATTAGCTACCTA...AAAGCCAATGCAGCTACGGTGATGACGACACTCGCTGAGTCCCGTTCACCGATGATTATTACACAAAATGGCGAGGCA---AAAGCGGTGATTCAAGATATTGCCTCTTATGAGCAGACTCAGGAA---ACTATAGCGTTGTTAAAGATTTTAGCTTTAGGACAACAACAAGTTAAA...GCAGGTGAAGTCACACCAGTAAAG
TRN  10010101110011000
NAM  Q8GNE6_9PROT/6-79
ASQ  QDIKPISYL.KSNTAQVVSSATETQRAIYITQNGEA-KVVIQDIKSFENTQN-TLTLLKLIVQSENEIN.ENKVIEQE
DSQ  CAAGATATTAAACCTATCAGCTATCTG...AAATCAAATACAGCTCAAGTTGTCAGTAGTGCCACTGAGACACAAAGAGCTATTTATATTACACAAAATGGTGAAGCT---AAAGTGGTTATTCAAGATATAAAATCATTTGAAAATACTCAAAAT---ACACTCACGCTTCTTAAATTAATTGTTCAAAGTGAAAATGAGATAAAT...GAAAATAAAGTGATAGAACAAGAG
TRN  10010101100011000
NAM  Q9RIC5_YERPE/1-69
ASQ  MKIETISYV.KKNAASL-----DLEEPILVTQNGV--PAYVIESYDAQQERQNAIALLKLLTLSEQDKA.DGNIFSKE
DSQ  ATGAAAATTGAAACCATTAGCTATGTG...AAAAAAAACGCAGCGTCACTC---------------GATCTGGAAGAACCAATTCTTGTTACTCAAAATGGGGTT------CCGGCATATGTTATTGAGTCATACGACGCGCAACAGGAGCGACAGAACGCGATTGCACTACTGAAGTTGCTGACGCTTTCAGAGCAAGATAAGGCA...GACGGCAATATTTTCAGTAAAGAA
TRN  11011101101011001
NAM  Q8PR83_XANAC/1-74
ASQ  MRTELVTTL.KRQATELLAAAERDKEPILITQHGLP-SAYLVDVASYERMQQ-RIALLEGIARGEMAVA.EGRTLSHE
DSQ  ATGCGCACCGAACTTGTCACCACGCTC...AAGCGTCAGGCGACCGAACTCCTTGCAGCTGCAGAGCGCGACAAGGAGCCAATCCTGATCACACAGCACGGTTTACCC---AGTGCCTATCTGGTGGATGTTGCCAGCTATGAGCGCATGCAGCAG---CGCATTGCGCTCCTCGAAGGAATCGCCCGTGGAGAAATGGCAGTCGCG...GAAGGCCGTACGCTGAGCCATGAA
TRN  11011111101111110
NAM  Q8CLX8_VIBVU/1-74
ASQ  MKVELVTSL.KRQATKILADLHDTKEPVLITEHGKP-SAYLVDVDDYEFMQN-RLAILEGIARGERALA.DGKVVSHD
DSQ  ATGAAAGTAGAACTAGTTACATCACTC...AAACGCCAAGCAACAAAGATCCTTGCCGATCTCCACGACACTAAAGAACCAGTGTTAATTACCGAACATGGTAAGCCA---TCGGCATATCTGGTTGATGTTGATGATTACGAGTTTATGCAAAAT---CGTTTAGCGATTCTTGAGGGGATTGCACGAGGTGAACGTGCATTAGCT...GACGGTAAAGTGGTGAGTCACGAT
TRN  11011101101011000
NAM  Q82UB6_NITEU/11-78
ASQ  EDVIPLADL.KVNPGRVVSRVKETRRPVLLTSRGRG-VAVVQDLDEYEKSQE-------ELAFVKAVAQ.GLMDIKEG
DSQ  GAAGATGTAATTCCCCTTGCAGATTTA...AAAGTCAATCCTGGTCGCGTTGTAAGCCGAGTTAAAGAAACTCGCAGACCTGTTCTTTTAACCAGTCGTGGCCGAGGT---GTGGCTGTAGTGCAAGACCTCGATGAATATGAAAAGAGCCAGGAA---------------------GAGCTGGCTTTTGTCAAAGCGGTTGCCCAA...GGTCTTATGGACATCAAAGAGGGC
TRN  10010101100011010
NAM  O70047_9ZZZZ/7-74
ASQ  EDVIPLSDL.KINPGKVVNRTQDTQRPILLTSRGRG-VAVVQGLEDYERAAE-------ELRFVKAVAQ.GLVDVREG
DSQ  GAAGATGTCATTCCTCTGTCAGATCTG...AAGATCAATCCCGGAAAGGTGGTTAATCGCACGCAGGATACACAACGGCCAATCCTGCTTACCAGTCGTGGCCGCGGT---GTTGCTGTTGTTCAGGGGCTTGAGGATTATGAGAGAGCCGCAGAG---------------------GAATTGCGGTTTGTCAAAGCGGTGGCGCAG...GGGCTGGTGGATGTTCGCGAGGGC
TRN  10010101100011001
NAM  Q8D9P8_VIBVU/8-81
ASQ  QDIQPLSEF.RAGVTSFIKQINETRRPLVITQRGKG-VAVVLDVAEYEAMQE-KIELLEEMRTAEAQLA.SGLGVSNE
DSQ  CAAGATATTCAGCCTTTGTCTGAATTT...CGTGCTGGCGTAACGTCATTTATTAAACAGATTAACGAAACTCGTAGACCATTAGTAATCACACAACGTGGTAAGGGT---GTTGCGGTTGTCCTTGATGTTGCGGAATATGAAGCAATGCAGGAG---AAGATCGAGTTACTGGAAGAAATGCGTACTGCTGAAGCACAATTAGCT...TCAGGTTTAGGTGTTTCCAATGAA
TRN  10010101100011000
NAM  Q82T18_NITEU/1-65
ASQ  MKAITAKDA.KNKFGEMLDTAQ--REPLTIEKHGRA-VAVIMSVQEYQQMKLERLRA--------KLAA.GEEQLDRG
DSQ  ATGAAAGCCATTACCGCTAAGGATGCA...AAAAATAAATTTGGGGAAATGCTGGATACTGCGCAG------CGGGAACCGCTTACCATCGAAAAACATGGACGGGCG---GTTGCCGTGATCATGTCAGTGCAGGAATATCAGCAAATGAAACTCGAAAGATTACGTGCA------------------------AAACTGGCAGCA...GGTGAGGAGCAACTGGACAGGGGA
TRN  10010101100011000
NAM  Q7N9R2_PHOLL/1-68
ASQ  MEIIPAQLA.KNQFGDLLMKVQ--REPVEISKHGKR-VAVVISPEEYDQFAQLKLQNLKA-----VLAE.SIAQADRG
DSQ  ATGGAAATTATTCCCGCACAACTAGCT...AAGAACCAGTTTGGTGATCTGCTTATGAAAGTTCAG------CGTGAACCTGTAGAAATTAGTAAGCATGGTAAACGT---GTGGCCGTGGTTATCTCTCCCGAAGAGTATGATCAGTTCGCACAGCTCAAGTTACAGAATTTAAAAGCC---------------GTTCTGGCTGAA...TCTATTGCACAAGCTGATCGTGGC
TRN  11011101101011010
NAM  Q7N5Y7_PHOLL/1-68
ASQ  MYELSANEV.KTHFGDMLLRAQ--RAPIQINKNGKL-VAVVLSIDEYENIEALKIQLLKS-----RAIQ.TKADIEEG
DSQ  ATGTATGAACTTTCTGCCAATGAAGTT...AAAACTCACTTTGGTGATATGCTGCTAAGAGCGCAG------CGTGCTCCAATCCAGATTAATAAGAACGGCAAGCTT---GTTGCTGTTGTCCTATCAATAGATGAATATGAAAACATTGAAGCGCTTAAGATTCAGCTTTTGAAATCC---------------AGAGCAATCCAA...ACCAAAGCTGATATTGAAGAAGGT
TRN  10010101100011001
NAM  Q8E847_SHEON/1-68
ASQ  MNTLSANEA.KIHFGDLLLKAQ--QSPIQINKNGKP-VAVVISADEYQSIEALKLHLLQS-----KAVK.AMTDIQTG
DSQ  ATGAACACTCTTTCAGCCAATGAAGCA...AAAATTCACTTTGGAGATTTGTTGCTCAAAGCCCAA------CAATCTCCAATCCAAATTAATAAAAATGGCAAGCCT---GTAGCCGTTGTAATTTCTGCTGATGAATACCAAAGTATCGAGGCGCTAAAATTACACTTGCTACAATCT---------------AAAGCGGTGAAA...GCCATGACCGACATCCAAACGGGC
TRN  11011101111011000
NAM  Q7DCR7_VIBCH/1-68
ASQ  MHTLTANDA.KRNFGELLLSAQ--REPVIISKNSKN-TVVVMSIKDFEELEAMKLDYLKH-----CFES.AQKDLDSG
DSQ  ATGCACACACTAACAGCAAATGATGCT...AAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAA------CGCGAACCTGTCATCATCAGCAAAAACAGTAAGAAT---ACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATCTCAAACAC---------------TGCTTTGAGTCT...GCTCAGAAAGACTTAGATAGTGGC
TRN  11011101111011010
NAM  Q9X102_THEMA/6-78
ASQ  VSFYSLADA.KARFSQVVEEAKTKD--VVVTKNGVP-AVAVIDYEKYKKLMEFMDEILDTYLLDIGNVE.KYLELKRY
DSQ  GTTTCTTTTTACAGTCTTGCGGACGCG...AAAGCGCGGTTCTCCCAGGTTGTCGAAGAAGCGAAAACGAAAGAC------GTGGTCGTGACAAAGAACGGTGTACCC---GCGGTTGCTGTCATTGACTACGAGAAATACAAAAAGCTCATGGAATTCATGGATGAGATCCTCGATACTTATCTGCTGGACATCGGGAACGTGGAG...AAGTATCTCGAGCTCAAAAGGTAT
TRN  10010101100011011
NAM  Q9FCD0_STRCO/2-76
ASQ  AYEIPVTQA.RAELADLINRVVYGGERVVVTRHGKP-LVALVSAADLARLEELRESPDAQVIASVAGVH.DASAASAP
DSQ  GCCTACGAGATTCCGGTGACGCAAGCC...AGGGCCGAGCTGGCCGACCTGATCAACCGGGTGGTGTACGGCGGCGAGCGCGTCGTCGTGACGCGGCACGGCAAGCCT---CTCGTCGCCCTCGTCTCCGCCGCCGACCTCGCGCGGCTGGAGGAGCTCCGCGAATCACCGGACGCCCAGGTGATCGCCTCGGTCGCCGGGGTCCAC...GACGCGTCCGCCGCCTCGGCACCC
TRN  10010101100011001
NAM  Q826S3_STRAW/2-76
ASQ  AYEIPVTQA.RAELADLINRVVYGGERVVVTRHGKP-LVALVSAADLERLDKLDAAEEQVVSAVSSVRE.VAAAPRER
DSQ  GCCTACGAGATTCCCGTGACGCAAGCC...AGGGCTGAGCTCGCCGATCTGATCAACCGTGTGGTGTACGGCGGCGAGCGCGTCGTCGTGACGCGGCACGGGAAGCCC---CTCGTCGCCCTGGTCTCCGCGGCCGATCTGGAGCGGCTCGACAAGCTGGACGCGGCGGAGGAGCAGGTGGTCAGCGCGGTGTCCAGCGTCCGCGAG...GTCGCCGCCGCACCCCGCGAGCGA
TRN  10010101100011011
NAM  Q8Y2S1_RALSO/6-78
ASQ  RDVIPLSQA.RANLSELAEQVKAGAEKIVTKNGES--YIALIDAQRLDYYHQLERARIHLLVLDEASK-.GLADVEAG
DSQ  CGCGACGTCATCCCGCTGTCCCAGGCC...CGCGCCAACCTCTCGGAACTGGCCGAGCAAGTAAAGGCGGGCGCGGAAAAGATCGTCACGAAGAACGGGGAGAGC------TACATCGCCCTGATCGACGCGCAGCGACTCGACTACTACCACCAGCTTGAACGGGCACGTATTCACCTGCTCGTGCTGGACGAGGCATCCAAA---...GGATTGGCCGATGTGGAAGCCGGG
TRN  11011101101011011
NAM  Q8PLK8_XANAC/10-84
ASQ  LEKSPAADIkVKGWPSLMRKVRSHGAVVITNHNHP--EAVVVDAEEYRRLVNQASAAAATSARAQSLQA.LQAKFDAH
DSQ  CTCGAAAAATCCCCCGCTGCCGACATCaagGTGAAGGGCTGGCCCAGCCTGATGCGCAAGGTGCGCTCGCACGGGGCAGTGGTGATCACCAACCACAATCATCCC------GAAGCGGTGGTGGTGGATGCCGAGGAGTATCGGCGCCTGGTCAATCAGGCCAGTGCGGCGGCCGCAACCTCGGCGCGCGCGCAGTCGCTGCAGGCA...CTGCAGGCGAAGTTCGACGCGCAT
TRN  11011101101011011
NAM  Q9ZH43_MORMO/8-81
ASQ  TTAASITDL.KKNPMGTVAEGE--GDAVAILNRNEP-AFYCVPPKLYAYYRELAEDAELNAVADERMKNpEIVKVNLD
DSQ  ACCACAGCGGCCAGTATTACTGACCTG...AAAAAAAATCCTATGGGAACCGTAGCTGAAGGTGAA------GGGGACGCTGTTGCGATCCTGAACCGAAACGAACCG---GCGTTCTATTGCGTTCCACCAAAACTTTACGCCTACTATCGGGAACTCGCTGAAGATGCTGAGTTAAACGCTGTTGCTGATGAGCGCATGAAAAACccgGAAATTGTGAAGGTTAACCTGGAT
TRN  11011101101011010
NAM  Q8ZPF8_SALTY/8-80
ASQ  TTAASITEL.KRDPMGTFNAGD--GAPVAILNRNEP-AFYCVPPALYAHLMDILEDEELGRIIDERANE.RVIEVNID
DSQ  ACTACTGCAGCAAGCATTACAGAACTG...AAACGTGATCCAATGGGAACTTTCAATGCCGGAGAT------GGCGCTCCAGTTGCCATTCTTAACCGCAATGAACCG---GCTTTCTACTGTGTGCCTCCGGCACTTTATGCTCATCTTATGGATATTCTTGAGGATGAAGAACTCGGTCGTATTATCGATGAGCGTGCGAATGAA...CGCGTCATTGAGGTCAACATTGAT
TRN  11011101101011011
NAM  Q8GEI6_ERWPY/8-80
ASQ  NTAASITDL.KRDPMGTVRAAE--GETIAILNRNEP-AFYCVPPAMYAYLMELAEDAELGCIVDDRMSE.LPVAKEIS
DSQ  AATACCGCAGCAAGCATCACGGATTTG...AAGCGCGACCCAATGGGCACAGTCCGTGCTGCCGAA------GGGGAAACTATCGCAATTTTAAACCGTAACGAGCCG---GCATTTTATTGCGTACCACCCGCTATGTACGCTTATCTGATGGAGCTGGCAGAGGATGCTGAGCTTGGATGTATCGTTGACGATCGCATGTCAGAG...TTACCGGTTGCGAAAGAGATATCA
TRN  10010101100011000
NAM  Q82UB1_NITEU/8-80
ASQ  EIAASISEL.KANPMKVVASGK--GMPIAVLNHNEP-AFYCVPAAAYEAMMELLDDIELLKIVKERMDE.PSVKVSLD
DSQ  GAAATTGCAGCCAGCATATCCGAGCTC...AAAGCCAACCCGATGAAGGTAGTAGCCAGCGGTAAA------GGCATGCCAATCGCCGTGCTAAACCACAACGAACCC---GCCTTTTATTGCGTACCCGCCGCCGCCTATGAAGCAATGATGGAATTGCTCGATGATATCGAGCTGCTAAAAATCGTGAAAGAACGAATGGACGAA...CCCAGCGTCAAGGTCTCGCTCGAT
TRN  10010101100011011
NAM  Q08800_VIBCH/8-80
ASQ  DVAASITEF.KANPMKVATSAF--GAPVAVLNRNEP-AFYCVPASTYEIMMDKLEDLELLAIAKERLSE.DSVSVNID
DSQ  GATGTTGCAGCAAGCATTACCGAATTT...AAAGCAAACCCAATGAAAGTTGCAACTAGTGCCTTC------GGTGCTCCTGTTGCTGTACTCAACCGAAATGAGCCG---GCTTTCTACTGCGTCCCTGCAAGCACCTACGAGATCATGATGGATAAGCTTGAAGATCTTGAGCTACTGGCTATTGCCAAAGAACGCTTAAGTGAA...GACAGCGTATCGGTAAATATCGAT
TRN  11011101101011010
NAM  Q7N4Q7_PHOLL/8-80
ASQ  DISASISEL.KKNPMATLSAGA--GYPIAILNRNQP-VFYCIPAELYEQILDALDDQELIRLVNERRGQ.ALVDVDLD
DSQ  GATATTAGCGCAAGCATTAGTGAACTT...AAAAAGAACCCTATGGCGACCCTTAGTGCCGGGGCT------GGATACCCTATTGCAATCCTAAATCGTAACCAACCC---GTGTTTTATTGTATTCCTGCGGAGCTCTATGAACAGATACTTGATGCTTTGGACGATCAAGAGCTTATTCGACTGGTAAATGAGCGTAGAGGGCAG...GCATTGGTTGATGTAGATTTGGAT
TRN  10010101100011011
NAM  Q60256_9ZZZZ/8-80
ASQ  DTSASVSEL.KKNPMATVSAGD--GFPVAILNRNQP-AFYCVPAELYEKMLDALDDQELVKLVAERSNQ.PLHDVDLD
DSQ  GATACAAGCGCCAGTGTCAGCGAGCTG...AAGAAAAACCCGATGGCGACAGTCAGCGCCGGTGAT------GGTTTCCCGGTCGCTATCCTGAACCGTAATCAGCCT---GCTTTCTACTGTGTACCCGCAGAGCTGTACGAAAAGATGCTTGATGCCCTAGACGATCAGGAGTTGGTTAAACTGGTAGCCGAACGCAGCAACCAA...CCGCTGCATGATGTAGATCTGGAT
TRN  11011101101011011
NAM  Q82UD0_NITEU/7-79
ASQ  SFSASISEL.KKNPTALLRKAE--GETIAILNHNLP-TAYLVPAEVYELLMEKLEDYELGEIVKARQAE.KHLAIEVS
DSQ  TCATTTAGCGCAAGCATCTCTGAATTA...AAGAAAAATCCAACAGCTTTGTTAAGAAAAGCCGAA------GGGGAAACTATCGCTATTCTCAACCATAACCTGCCA---ACCGCTTACCTTGTTCCAGCCGAGGTATACGAGTTGTTGATGGAGAAATTGGAAGATTATGAATTAGGCGAAATTGTTAAGGCCAGGCAAGCGGAA...AAACATTTGGCAATTGAAGTATCG
TRN  10010101100011000
NAM  Q9KMA1_VIBCH/14-86
ASQ  NCSASISEL.KKNPTALLNEAD--GSAIAILNHNKP-AAYLVPAETYEYLIDMLDDYELSQIVDSRRAD.LAQAVEVN
DSQ  AATTGCTCTGCAAGTATTTCAGAGTTA...AAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGAT------GGGTCTGCAATTGCAATTTTAAACCACAACAAGCCA---GCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCGATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGAC...TTAGCACAAGCTGTGGAAGTAAAT
TRN  11011111111111100
NAM  Q88JZ5_PSEPK/7-79
ASQ  EAAVSISEL.KKNPSRILAEAA--GAPVALLDQDRV-MAYLVPAELYEQILERLDDFELAALAKALAAE.KSIRVSLE
DSQ  GAGGCAGCAGTCAGCATTTCTGAGCTG...AAGAAAAATCCATCCCGCATCTTGGCTGAAGCCGCA------GGTGCCCCAGTAGCCTTGCTCGACCAGGATCGTGTT---ATGGCATATCTGGTGCCAGCAGAGCTGTACGAACAAATACTGGAGCGCCTGGACGATTTCGAGCTGGCTGCATTGGCGAAGGCTCTGGCAGCTGAA...AAATCCATCCGGGTGTCCTTGGAA
TRN  10010101100011011
NAM  YAFN_ECOLI/7-76
ASQ  EKSVNITEL.RKNPAKYFI-----DQPVAVLSNNRP-AGYLLSASAFEALMDMLAEQEEKKPIKARFRP.SAARLEEI
DSQ  GAAAAATCGGTCAATATCACTGAGTTA...CGTAAAAACCCAGCTAAATACTTTATT---------------GATCAACCGGTTGCGGTTCTTTCTAATAATCGCCCC---GCAGGATATCTCTTAAGTGCCAGCGCATTCGAAGCGTTAATGGACATGCTTGCTGAACAAGAGGAGAAAAAGCCCATAAAGGCGCGCTTCCGTCCA...AGTGCTGCAAGATTAGAGGAAATT
TRN  10010101110011010
NAM  Q8RBG2_THETN/22-97
ASQ  SYMISVSDLgRGKASKIIEKVAKKKEHYIVVKNNKP-QAVIIPIEEYDELIEAQEDLELLQLAIERTKN.LKEGETLP
DSQ  TCGTATATGATTTCCGTGAGTGATTTAgggAGAGGAAAAGCATCAAAAATTATAGAGAAGGTTGCTAAAAAAAAGGAACATTATATAGTTGTTAAAAATAACAAACCT---CAAGCAGTAATTATACCTATCGAAGAATATGATGAACTTATAGAAGCACAGGAAGACCTTGAACTTTTACAGCTTGCAATCGAAAGGACAAAAAAT...TTAAAAGAAGGAGAAACTTTGCCT
TRN  10010101110011000
NAM  Q82VL3_NITEU/3-76
ASQ  ITTLSSREL.NQDIGRAKRAARNGPVIITDRGKP---VHVLLSYDEYQRIIGQQENIVDQLGLPSGIEDvEVEFPRSR
DSQ  ATTACAACGCTTTCCAGCCGGGAACTC...AATCAGGATATCGGACGGGCCAAGCGCGCTGCCCGCAACGGCCCGGTCATCATCACCGACCGGGGTAAGCCC---------GTGCATGTGCTGCTGTCTTACGACGAGTACCAGCGCATCATCGGCCAGCAGGAAAACATCGTCGATCAGCTCGGCCTGCCATCGGGCATCGAAGATgtgGAAGTGGAGTTCCCCCGCTCGCGC
TRN  11011111101111111
NAM  Q8KL67_RHIET/5-75
ASQ  SETYSTSDL.SRKSGDIIAEALRHPVTITQRNKP---RLVLLNIEDYQQLIRQADR--RTVGTIETMPD.ELFAELEN
DSQ  AGCGAGACGTATTCAACCAGTGACCTC...TCACGTAAATCCGGCGACATCATCGCCGAGGCGCTGCGTCATCCGGTGACGATCACCCAGCGGAACAAACCC---------CGGCTGGTTCTCCTCAATATCGAAGATTATCAGCAACTGATCAGGCAGGCAGACCGA------CGCACCGTCGGCACTATCGAAACGATGCCCGAT...GAGCTTTTTGCCGAACTCGAAAAC
TRN  10010101100011001
NAM  Y4EA_RHISN/5-75
ASQ  GGSYSTSDL.SRKSGDIIAEALRHPVTITQRNKP---RLVLLNIDDYERLMRQYDA--RSVGTLETLPG.ELLNEFEA
DSQ  GGTGGTTCCTACTCAACAAGCGATCTA...TCCCGGAAGTCCGGCGATATCATCGCCGAGGCGTTGCGCCATCCGGTCACGATCACCCAACGCAACAAGCCG---------CGCCTCGTCCTCCTTAACATCGACGACTACGAACGGCTGATGCGGCAATACGATGCC------CGTTCAGTCGGCACACTCGAAACCCTGCCGGGC...GAGCTGCTCAACGAATTCGAGGCG
TRN  11011111101111101
NAM  Q8YUZ9_ANASP/1-76
ASQ  MKKVTLTEL.SNNIEHLLDEVVETGIPIEINKNGKLFKIVPVEKTDKLKNLIFKPDVIQGNPDDLVNIS.WEQEINID
DSQ  ATGAAAAAGGTGACATTAACAGAATTG...AGTAATAATATTGAGCATCTATTAGATGAGGTAGTAGAAACAGGTATTCCCATAGAAATTAATAAAAATGGTAAGCTATTTAAAATAGTTCCTGTGGAAAAAACCGATAAACTTAAAAACTTGATTTTTAAGCCAGATGTGATTCAAGGAAATCCCGATGATTTAGTTAATATAAGT...TGGGAGCAGGAGATTAATATTGAT
TRN  10010101110011010
NAM  Q8RAX6_THETN/1-75
ASQ  MMQVSSTEF.KNNVGKFLKLSEKEDILILKNGKPVA-KLTAVSKNEKEIAYDRLLEMIKKSKPVTEEID.LKAAREER
DSQ  ATGATGCAGGTTAGTTCCACAGAATTT...AAAAACAATGTAGGAAAGTTTCTAAAACTCTCAGAAAAGGAGGACATTTTAATTTTAAAAAACGGAAAGCCTGTAGCA---AAGCTTACAGCTGTATCAAAAAATGAGAAAGAAATTGCTTATGATAGGCTTTTAGAAATGATAAAAAAGAGTAAACCAGTTACCGAAGAAATTGAT...TTGAAAGCAGCAAGAGAGGAGAGA
TRN  10010101110011000
NAM  Q82T22_NITEU/1-74
ASQ  MHVWPVQDA.KARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAARP--SLKQLLLSDSART.EMLVPERG
DSQ  ATGCATGTCTGGCCTGTTCAAGATGCC...AAGGCTCGCTTTAGCGAGTTTCTGGACGCCTGCATAACCGAAGGACCCCAGATTGTTTCCCGCCGGGGCGCCGAAGAAGCGGTATTGGTGCCCATTGGAGAATGGCGGCGCCTGCAAGCGGCTGCACGCCCC------TCGCTTAAGCAATTGTTGCTCTCTGACTCAGCCCGCACT...GAGATGCTCGTTCCCGAGCGAGGC
TRN  10010111100111001
NAM  Q7NI03_GLOVI/2-75
ASQ  QSTWQLQEA.KNQFSKVVDLAVTVGPQIVTRHGEPVAVILSVAQYRKLTVPRQS--LVDFLRSSPLVGA.QIDLRRTE
DSQ  CAGAGCACCTGGCAGCTGCAAGAAGCA...AAAAACCAATTTTCAAAGGTTGTGGACTTGGCCGTAACTGTAGGGCCACAGATTGTCACTCGCCATGGCGAGCCTGTGGCAGTAATCCTGTCGGTGGCTCAGTACCGTAAACTGACCGTGCCGCGCCAATCG------CTCGTCGATTTTTTGCGCTCTTCGCCGCTGGTAGGAGCG...CAAATCGACCTCAGGCGTACTGAA
TRN  10010101100011001
NAM  Q89SG5_BRAJA/14-86
ASQ  DDTWTLANA.KARLSQVIDRAQTG-PQIITRHGKPNAVIVSAEEWARKTARKGT--LAEFLLASPLRGA.DLALERMH
DSQ  GATGACACGTGGACGCTTGCCAACGCC...AAGGCACGACTGTCCCAGGTGATCGACCGCGCCCAAACCGGC---CCGCAGATCATCACCCGTCACGGCAAGCCGAACGCCGTGATCGTTTCCGCAGAGGAATGGGCCCGCAAGACCGCACGCAAAGGCACG------TTGGCCGAATTCCTACTGGCCTCGCCGCTGCGCGGCGCC...GACCTCGCACTTGAACGCATGCAC
TRN  11011101101011011
NAM  Q8Y121_RALSO/1-74
ASQ  MQSWQMQAA.KARFSDVVKRAADDGPQEITVHGRPVAVVISRALFDRLSGSGES--LVSFMRQSPLADQ.DDVVFERE
DSQ  ATGCAAAGCTGGCAAATGCAGGCCGCC...AAGGCGCGGTTTTCCGATGTCGTGAAGCGGGCAGCAGACGACGGCCCGCAGGAAATCACCGTGCATGGCCGCCCGGTGGCGGTAGTGATCTCGCGCGCACTGTTCGATCGCTTGAGCGGCAGCGGTGAGTCA------CTGGTCAGCTTCATGCGCCAATCCCCGCTGGCCGATCAG...GACGATGTCGTTTTTGAGCGCGAG
TRN  11011111101111101
NAM  Q7PA58_RICSI/1-74
ASQ  MNKWQLHEA.KNKLSNIIDIAMHGTPQCITKRGEE--AVVIISIKDYKQLTKQKPDFKEYLLSIPKTDN.LDIQRAKG
DSQ  ATGAATAAATGGCAGTTACACGAAGCA...AAGAATAAGTTAAGTAATATTATTGATATTGCAATGCATGGTACCCCTCAATGTATTACAAAAAGGGGTGAAGAA------GCAGTTGTAATTATTAGTATAAAAGACTATAAACAACTTACTAAACAAAAACCTGATTTCAAAGAATATTTATTGAGCATACCTAAGACAGATAAT...TTGGATATTCAGAGAGCAAAAGGA
TRN  10010101110011010
NAM  Q9AH45_NEIME/1-74
ASQ  MFQANIHQA.KTNLSQLIQRAEAGEIVIIAKAGKPCVQLTGIEKPARNAGRLKK--FSHMENTDISRIL.EDDNETAA
DSQ  ATGTTTCAAGCAAATATTCATCAGGCA...AAAACCAATTTGAGTCAATTGATTCAAAGAGCAGAAGCAGGGGAAATCGTTATTATTGCGAAGGCAGGTAAGCCTTGCGTCCAACTAACCGGTATTGAAAAACCGGCACGAAATGCAGGAAGGTTGAAAAAA------TTCAGTCATATGGAAAATACGGATATTTCACGTATTCTT...GAGGATGACAATGAAACGGCAGCT
TRN  10010101110011001
NAM  Q87UE9_PSESM/1-69
ASQ  MQTHNIHAA.KTHFSQLVDAAAGGETIIIAKAGIPVAKLVPISAPKRRGMLSHV--MFDAEASDAM---.--DAEITE
DSQ  ATGCAAACCCACAACATCCACGCAGCC...AAAACCCACTTCTCGCAGCTGGTCGACGCAGCGGCGGGTGGCGAAACGATTATTATCGCCAAAGCAGGCATACCGGTTGCCAAGCTGGTGCCCATTTCTGCACCCAAGCGCAGAGGAATGTTGAGCCACGTG------ATGTTTGACGCAGAAGCCTCGGATGCCATG---------...------GACGCAGAAATTACAGAG
TRN  10010101100011011
NAM  Q92K09_RHIME/1-70
ASQ  M-QVTIRNP.KTNLSKLIEAAKAGEEVVIAKGTVPVARVVALPQNKFTIGLTAA--LERWQNKGLDFR-.--GSVKAG
DSQ  ATG---CAGGTTACCATCCGTAACCCC...AAAACGAACCTGTCCAAACTTATCGAGGCGGCGAAGGCGGGCGAAGAAGTCGTCATCGCCAAGGGAACAGTCCCTGTTGCCCGGGTCGTTGCCCTTCCGCAAAACAAGTTCACGATCGGGCTGACGGCTGCA------CTTGAACGTTGGCAAAACAAAGGGTTGGATTTTCGC---...------GGCTCGGTGAAAGCGGGC
TRN  11011101101011011
NAM  Q92SQ5_RHIME/1-72
ASQ  MDAVNLADA.KAHLSELVDRVEAGDSIEITRRGKPVARLTAVARPRK----RIDAALLQSLTATMPLQS.GSAADLVR
DSQ  GTGGACGCAGTCAATCTGGCGGATGCC...AAGGCACATCTGAGTGAGCTTGTCGATCGGGTCGAGGCGGGGGATTCGATCGAAATCACTCGGCGCGGAAAGCCTGTCGCCCGGCTTACGGCCGTGGCCAGGCCGCGCAAG------------CGGATCGATGCAGCCCTGCTCCAGTCGCTTACGGCGACCATGCCGCTACAGTCC...GGCAGCGCCGCCGATCTGGTGCGT
TRN  10010101100011011
NAM  Q7NMY2_GLOVI/2-76
ASQ  IFTVGAFEA.KTHFANLLERVARGEQIVITRHGTPVARLVPISGNDRERAKQTIT-RLKEFSRGQTLEG.LSIRALRE
DSQ  ATCTTCACCGTCGGTGCTTTCGAAGCC...AAAACCCATTTTGCCAACCTGCTTGAGCGTGTCGCTCGGGGTGAGCAAATCGTCATCACCCGCCATGGAACGCCAGTGGCTCGACTCGTGCCGATTTCCGGCAACGACCGCGAGCGGGCGAAGCAGACGATCACC---CGGTTGAAAGAATTCAGCCGGGGGCAAACTCTTGAAGGG...CTTTCCATCCGTGCCTTGCGGGAA
TRN  11011101101011011
NAM  Q7NK01_GLOVI/1-75
ASQ  MITVGAFEA.KTHLSALLDRVERGEVVVITRHGKPVAQLIAAGATERSNVEQTIA-KLKALRKGSSLAP.FSWKELRD
DSQ  ATGATTACCGTCGGTGCCTTTGAAGCG...AAAACCCATCTGTCGGCTCTGCTTGACCGCGTCGAGCGCGGCGAGGTGGTTGTGATTACCAGGCACGGCAAACCGGTGGCCCAGCTGATCGCAGCCGGAGCTACGGAGCGTTCAAACGTCGAGCAAACCATTGCC---AAGTTGAAGGCTCTGCGCAAGGGCAGCAGCCTCGCCCCG...TTCTCCTGGAAGGAGCTGCGCGAT
TRN  10010101100011001
NAM  Y3441_MYCBO/8-83
ASQ  VEAIGIREL.RQHASRYLARVEAGEELGVTNKGRLVARLIPVQAAERSREALIESGVLIPARRPQNLLD.VTAEPARG
DSQ  GTGGAGGCAATCGGAATCCGAGAACTA...AGACAGCACGCATCGCGATACCTCGCCCGGGTTGAAGCCGGCGAGGAACTTGGCGTCACCAACAAAGGAAGACTTGTGGCCCGACTCATCCCGGTGCAGGCCGCGGAGCGTTCTCGCGAAGCCCTGATTGAATCAGGTGTCCTGATTCCGGCTCGTCGTCCACAAAACCTTCTCGAC...GTCACCGCCGAACCGGCGCGCGGC
TRN  10010101100011001
NAM  P96916_MYCTU/1-74
ASQ  MSEVASREL.RNDTAGVLRRVRAGEDVTITVSGRPVAVLTPVRPRRRRWLSKTE--FLSRLRGAQADPG.LRNDLAVL
DSQ  ATGTCTGAGGTGGCCTCGCGTGAGCTG...CGTAACGATACGGCCGGCGTGCTGCGCCGCGTGCGGGCAGGGGAGGACGTCACCATCACCGTCAGCGGCCGTCCGGTCGCGGTGCTTACCCCGGTTCGTCCGCGGCGCCGGCGTTGGCTGAGCAAAACGGAG------TTCCTGTCGCGGTTGCGCGGCGCTCAAGCCGATCCCGGG...CTCCGTAACGACCTCGCGGTCCTT
TRN  11011101101011011
NAM  O07782_MYCTU/2-74
ASQ  SATIPARDL.RNHTAEVLRRVAAGEEIEVLKDNRPVARIVPLKRRRQ---WLPAAEVIGELVRLGPDTT.NLGEELRE
DSQ  TCTGCTACGATACCCGCTCGCGATCTT...CGCAACCACACCGCCGAGGTACTGCGGCGAGTTGCCGCCGGCGAGGAAATCGAGGTGCTCAAGGACAATCGCCCCGTAGCGCGCATCGTTCCGCTCAAGCGGCGCCGCCAA---------TGGTTGCCAGCTGCCGAGGTGATCGGCGAACTGGTGCGCTTGGGCCCCGATACCACC...AATCTGGGCGAGGAGCTGCGAGAG
TRN  10010111100111011
NAM  O50412_MYCTU/12-84
ASQ  MTSVGVRAL.RQRASELLRRVEAGETIEITDRGRPVALLSPLPQGGPYEQLLASGEIERATLDVVDL--.-PEPLDLD
DSQ  ATGACCTCGGTGGGGGTGCGTGCGCTG...CGGCAGCGGGCCAGCGAGCTGCTGCGCCGAGTCGAGGCCGGCGAGACGATCGAGATCACCGACCGCGGCCGGCCCGTCGCCCTGCTCTCGCCGCTGCCGCAGGGCGGTCCATACGAGCAGCTGCTGGCAAGCGGCGAGATCGAGCGTGCCACGCTCGACGTCGTTGATCTG------...---CCCGAACCGCTCGACCTCGAC
TRN  11011111101111111
NAM  Q92JV5_RHIME/2-77
ASQ  EEAVSAADA.NRKFSLILRSVREGHSYVVTSHGRPVARIVPAAKSDNAVSGARTALLSRLERQPAVIAG.RWTRDELY
DSQ  GAAGAAGCCGTTTCGGCAGCGGATGCC...AACCGCAAGTTTTCTCTTATCCTGCGCAGCGTGCGGGAGGGGCACAGCTATGTCGTGACGAGCCACGGACGGCCTGTCGCGCGCATCGTTCCCGCCGCCAAAAGCGATAACGCGGTTTCCGGTGCGCGAACAGCGCTGCTGTCGCGCCTCGAACGTCAGCCCGCCGTGATTGCCGGG...CGCTGGACCCGCGATGAGCTTTAC
TRN  11011101101011011
NAM  Q8R721_THETN/2-77
ASQ  EKVIGIDKL.RPKLGEYLKEVEKGDVIIVSSRSEPKGVLISYSMYNQLKEFEKKAKQLEIMQILNEFRD.KAEKAGLS
DSQ  GAAAAAGTTATTGGAATAGACAAATTA...AGACCCAAATTAGGGGAATATTTAAAAGAAGTCGAAAAAGGAGATGTAATAATTGTTTCTTCTCGATCTGAGCCAAAAGGAGTGTTAATTAGTTATTCTATGTACAATCAATTAAAGGAGTTTGAAAAAAAAGCAAAACAGCTGGAAATCATGCAAATCTTAAATGAATTTAGAGAT...AAAGCAGAAAAAGCAGGACTGTCT
TRN  10010101100011010
NAM  Q8F586_LEPIN/1-76
ASQ  MKSIGIKDL.KNNLSSYLEFVKKGETIIIYDRNNPIAEIKKILKTDNRTDLYIKEATENNSLIPAKKFK.EIKFPKVK
DSQ  ATGAAATCGATCGGAATTAAAGATCTA...AAAAACAATCTTAGCAGTTACCTTGAATTCGTAAAAAAAGGTGAAACTATTATTATCTATGATAGAAACAACCCTATTGCTGAAATCAAAAAAATTCTTAAAACTGACAATAGAACTGATCTATATATCAAAGAGGCTACTGAAAATAATTCTCTCATTCCTGCTAAAAAATTCAAA...GAAATTAAATTCCCTAAAGTTAAA
TRN  10010101110011011
//