EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02589 - DUF162)
FAM  PF02589
PID  DUF162
DES  Uncharacterized ACR, YkgG family COG1556
IPR  IPR003741
ANO  4
ALN  141
AID  0.298103
APH  ((Q9ZMU3_HELPJ/83-211:0.69316,O29448_ARCFU/1-120:1.30821):0.87221,YKGG_ECOLI/93-228:0.38311,O32259_BACSU/97-237:0.43505);
ATP  ((Q9ZMU3_HELPJ/83-211,O29448_ARCFU/1-120),YKGG_ECOLI/93-228,O32259_BACSU/97-237);
ATL  3.69177
DNO  3
DLN  423
DID  0.388982
DPH  (Q9ZMU3_HELPJ/83-211:0.48694,O32259_BACSU/97-237:0.70188,O29448_ARCFU/1-120:0.76521);
DTP  (Q9ZMU3_HELPJ/83-211,O32259_BACSU/97-237,O29448_ARCFU/1-120);
DTL  1.95403
RID  0.260495
RPH  (Q9ZMU3_HELPJ/83-211:0.81774,O32259_BACSU/97-237:1.24566,O29448_ARCFU/1-120:1.26561);
RTP  (Q9ZMU3_HELPJ/83-211,O32259_BACSU/97-237,O29448_ARCFU/1-120);
RTL  3.32901
LNK  O29448_ARCFU/1-120:O29448:AE001048
LNK  O32259_BACSU/97-237:O32259:Z99121
LNK  Q9ZMU3_HELPJ/83-211:Q9ZMU3:AE001451
LNK  YKGG_ECOLI/93-228:P77433:
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9ZMU3_HELPJ/83-211
ASQ  NLNFEAFKDFTLQPYDKEI-------EAMREELFEIDTAL-LHGVCGISSLGMIGAVSS---HASPRLLSLITLNCIILLKKESIVRNLSEGVQALKNQGQNGA-LPTNMLLIGGPSRTADIELKTVFGVHGPQKVAVILY
DSQ  AATTTGAATTTTGAAGCGTTTAAGGATTTCACTTTACAGCCCTATGACAAAGAAATT---------------------GAAGCGATGCGTGAAGAATTGTTTGAGATTGATACCGCTTTA---TTGCACGGGGTTTGTGGGATTTCAAGCTTGGGCATGATTGGGGCGGTTTCTTCG---------CATGCAAGCCCACGGTTGCTTTCGCTCATCACCCTTAATTGCATCATTTTATTGAAAAAAGAATCCATTGTGCGCAACTTGAGTGAAGGCGTGCAAGCTTTAAAAAATCAAGGCCAAAACGGCGCA---TTACCCACAAACATGCTCCTTATTGGCGGGCCTAGCCGGACAGCTGACATTGAATTAAAAACCGTTTTTGGGGTGCATGGGCCTCAAAAAGTCGCTGTCATTCTCTAT
TRN  11011101111011000
NAM  O32259_BACSU/97-237
ASQ  RFEEYGLKSLLTKDWPSEGTPVWEWDADKGEENIKKAEQANVGITFSEITLAESGTVVLFSSKDIGRSVSLLPTTYIAIVPKSSIVPRMTQASDIIRQNIANGVTVPSCINYITGPSNSADIEMDLVVGVHGPVKAAYILV
DSQ  CGCTTTGAAGAATACGGACTGAAAAGCCTGCTCACCAAGGACTGGCCGAGTGAAGGAACGCCGGTCTGGGAGTGGGATGCTGACAAAGGCGAGGAAAATATTAAAAAAGCGGAGCAAGCCAATGTAGGGATTACATTCAGCGAAATTACATTGGCTGAGTCGGGGACGGTTGTCCTCTTCTCCTCAAAAGACATCGGCCGCTCTGTCAGCCTTTTGCCAACGACTTATATTGCGATCGTGCCGAAATCAAGCATTGTACCGAGAATGACACAAGCCAGTGATATCATCCGCCAAAACATTGCGAACGGTGTCACTGTTCCTTCATGTATCAACTACATTACCGGACCGAGTAACTCAGCCGACATTGAAATGGATTTAGTTGTGGGGGTGCATGGACCAGTAAAGGCAGCATATATTCTCGTC
TRN  10010101100011000
NAM  YKGG_ECOLI/93-228
ASQ  RLEELGISERLQQECNAVV-----WDPAKGAENISQAEQAKVGVVYAEYGLTESGGVVLFSAAERGRSLSLLPEYSLFILRKSTILPRVAQLAEKLHQKAQAGERMPSCINIISGPSSTADIELIKVVGVHGPVKAVYLII
NAM  O29448_ARCFU/1-120
ASQ  MKIVEALKANGVEVIITEK-------ADVLIKNFEN-----AHISYALSADEKTGVIFFG--GFEEKMKAGLAEHHVAILKEEDVKENILLAYEHARRKS-------DVLFASSSASKTADIEGKTVFGMHGPRKFTVVLV
DSQ  ATGAAGATTGTAGAAGCTCTGAAGGCGAACGGAGTGGAGGTTATTATTACCGAGAAA---------------------GCTGATGTTCTGATAAAGAATTTTGAGAAT---------------GCTCACATAAGCTATGCGTTGAGTGCGGATGAAAAGACAGGAGTCATCTTTTTTGGA------GGCTTCGAGGAAAAGATGAAGGCCGGACTTGCCGAGCACCATGTTGCGATTCTGAAGGAGGAGGACGTGAAAGAAAACATACTGCTGGCCTACGAACACGCTCGAAGAAAATCC---------------------GACGTTCTTTTTGCCTCAAGCAGTGCCTCAAAGACTGCGGACATTGAAGGAAAGACCGTCTTCGGCATGCACGGGCCGAGAAAGTTCACGGTAGTGCTGGTG
TRN  10010101100011001
//