EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02562 - PhoH)
FAM  PF02562
PID  PhoH
DES  PhoH-like protein
IPR  IPR003714
ANO  6
ALN  207
AID  0.590755
APH  (PHOL_MYCTU/125-329:0.24552,(PHOL_ECOLI/130-334:0.23947,O67366_AQUAE/121-325:0.23858):0.08130,((PHOH_ECOLI/148-354:0.74012,PHOL_SYNY3/110-314:0.22629):0.09547,PHOL_BACSU/112-316:0.20936):0.06355);
ATP  (PHOL_MYCTU/125-329,(PHOL_ECOLI/130-334,O67366_AQUAE/121-325),((PHOH_ECOLI/148-354,PHOL_SYNY3/110-314),PHOL_BACSU/112-316));
ATL  2.13966
DNO  6
DLN  621
DID  0.571491
DPH  ((((PHOL_BACSU/112-316:0.23365,O67366_AQUAE/121-325:0.32603):0.06915,PHOH_ECOLI/148-354:0.51946):0.06030,PHOL_SYNY3/110-314:0.29454):0.10075,PHOL_ECOLI/130-334:0.27568,PHOL_MYCTU/125-329:0.24821);
DTP  ((((PHOL_BACSU/112-316,O67366_AQUAE/121-325),PHOH_ECOLI/148-354),PHOL_SYNY3/110-314),PHOL_ECOLI/130-334,PHOL_MYCTU/125-329);
DTL  2.12777
RID  0.590755
RPH  (PHOL_MYCTU/125-329:0.24552,(PHOL_ECOLI/130-334:0.23947,O67366_AQUAE/121-325:0.23858):0.08130,((PHOH_ECOLI/148-354:0.74012,PHOL_SYNY3/110-314:0.22629):0.09547,PHOL_BACSU/112-316:0.20936):0.06355);
RTP  (PHOL_MYCTU/125-329,(PHOL_ECOLI/130-334,O67366_AQUAE/121-325),((PHOH_ECOLI/148-354,PHOL_SYNY3/110-314),PHOL_BACSU/112-316));
RTL  2.13966
LNK  O67366_AQUAE/121-325:O67366:AE000736
LNK  PHOH_ECOLI/148-354:P31544:D10391
LNK  PHOL_BACSU/112-316:P46343:D84432
LNK  PHOL_ECOLI/130-334:P77349:U00096
LNK  PHOL_MYCTU/125-329:O05830:BX842579
LNK  PHOL_SYNY3/110-314:P73090:D90903
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O67366_AQUAE/121-325
ASQ  AIVPKTETQKKYVEAIKKNDIVFGIGPAGTGKTYLAMAMALQHLKEGKVNKIILTRPAVEAGEKLGFLPGTIAEKVHPYLTPLYDALYDMVDYDKANYML--ERNIIEIAPLAFMRGRTLNDAFIILDEAQNATRDQMKMFLTRIGFGSKAVITGDVTQIDLPKKKESGLIEAMEVLKNIEGIEFIFFKQTDVVRHPIVAKIINAYE
DSQ  GCAATAGTTCCCAAGACCGAAACCCAAAAGAAGTACGTAGAAGCCATAAAGAAGAACGACATAGTGTTCGGTATAGGTCCCGCAGGTACGGGAAAAACATACCTCGCTATGGCTATGGCCCTCCAGCACCTCAAGGAAGGTAAGGTAAACAAGATCATCTTAACGAGACCAGCGGTAGAGGCGGGAGAAAAGCTCGGATTCCTTCCGGGAACTATAGCTGAAAAGGTTCACCCTTACCTCACTCCACTCTACGACGCCCTATACGATATGGTGGACTACGACAAGGCTAACTACATGCTT------GAAAGAAACATAATAGAGATAGCTCCCCTTGCCTTTATGAGAGGAAGAACCTTAAACGATGCCTTCATAATCCTCGATGAAGCACAAAACGCAACCAGGGACCAGATGAAGATGTTTTTAACGAGGATAGGATTTGGCTCTAAGGCAGTAATCACCGGTGACGTTACGCAGATAGACCTTCCCAAGAAAAAAGAGTCTGGACTAATAGAAGCTATGGAAGTTCTCAAAAACATAGAAGGTATAGAGTTTATATTCTTCAAACAAACGGACGTTGTGAGACACCCGATAGTTGCTAAGATTATTAACGCTTATGAG
TRN  10010101110011010
NAM  PHOL_BACSU/112-316
ASQ  SIRVKTMGQREYVAAMKRNDLVFGIGPAGTGKTYLAVVKAVHALKNGHIKKIILTRPAVEAGESLGFLPGDLKEKVDPYLRPLYDALHDVLGADHTERLM--ERGIIEIAPLAYMRGRTLDDAYVILDEAQNTTPAQMKMFLTRLGFSSKMIITGDVSQIDLPKGVKSGLAVAKEMLKGIDGISMIELDQTDVVRHPLVAKIIEAYD
DSQ  TCAATCCGTGTAAAAACAATGGGACAGCGGGAATACGTGGCCGCTATGAAGCGGAATGACCTTGTATTCGGCATTGGTCCGGCGGGAACCGGGAAAACGTACCTGGCTGTCGTAAAAGCAGTCCATGCTTTAAAAAACGGACATATCAAAAAAATCATTTTAACAAGACCTGCCGTGGAAGCCGGTGAAAGCCTTGGTTTTCTCCCAGGTGACCTAAAAGAAAAAGTAGATCCTTATTTGCGCCCGCTGTATGACGCTCTCCATGATGTGCTTGGGGCAGATCATACAGAACGTCTGATG------GAAAGAGGCATCATTGAAATTGCTCCGCTCGCATATATGAGGGGACGGACGCTCGATGATGCTTATGTTATACTTGATGAAGCACAGAATACCACGCCTGCTCAAATGAAAATGTTTTTGACGAGACTGGGTTTTAGCTCTAAAATGATCATTACAGGTGACGTTAGCCAAATTGATCTGCCGAAAGGCGTCAAATCGGGACTTGCAGTAGCGAAGGAGATGCTGAAAGGAATAGACGGCATTTCTATGATTGAGCTAGACCAGACAGACGTGGTCAGACATCCGCTTGTTGCGAAAATTATTGAAGCATACGAT
TRN  10010101100011000
NAM  PHOL_MYCTU/125-329
ASQ  TIRPKTLNQKRYVDAIDANTIVFGIGPAGTGKTYLAMAKAVHALQTKQVTRIILTRPAVEAGERLGFLPGTLSEKIDPYLRPLYDALYDMMDPELIPKLM--SAGVIEVAPLAYMRGRTLNDAFIVLDEAQNTTAEQMKMFLTRLGFGSKVVVTGDVTQIDLPGGARSGLRAAVDILEDIDDIHIAELTSVDVVRHRLVSEIVDAYA
DSQ  ACGATCCGGCCCAAGACGCTCAACCAGAAACGCTACGTGGACGCGATCGACGCCAACACCATCGTCTTCGGAATCGGCCCGGCCGGCACCGGAAAGACCTATCTTGCGATGGCCAAAGCGGTCCACGCGCTGCAGACCAAGCAGGTGACCCGCATAATCTTGACCCGACCCGCGGTGGAAGCCGGTGAACGCCTTGGATTTCTGCCGGGCACGCTGAGCGAAAAGATCGATCCGTACCTACGACCGCTCTATGACGCGCTGTACGACATGATGGACCCCGAGCTGATCCCGAAGCTGATG------TCCGCTGGAGTCATCGAGGTGGCACCGCTGGCGTACATGCGGGGTAGAACCCTGAATGACGCGTTCATCGTCCTGGACGAGGCGCAGAACACCACGGCCGAGCAGATGAAGATGTTCCTCACCCGCCTGGGCTTCGGATCCAAGGTCGTGGTCACCGGAGATGTCACCCAGATCGACCTGCCGGGCGGCGCCCGGTCGGGTCTGCGGGCGGCGGTCGACATCCTCGAAGACATCGACGACATCCATATCGCGGAGCTGACCAGCGTGGATGTGGTACGCCACCGTCTGGTCTCGGAGATCGTGGACGCTTATGCG
TRN  10010101100011011
NAM  PHOL_ECOLI/130-334
ASQ  VIKPRTPNQAQYIANILDHDITFGVGPAGTGKTYLAVAAAVDALERQEIRRILLTRPAVEAGEKLGFLPGDLSQKVDPYLRPLYDALFEMLGFEKVEKLI--ERNVIEVAPLAYMRGRTLNDAFIILDESQNTTIEQMKMFLTRIGFNSKAVITGDVTQIDLPRNTKSGLRHAIEVLADVEEISFNFFHSEDVVRHPVVARIVNAYE
DSQ  GTAATTAAGCCGCGCACGCCAAACCAGGCGCAGTACATCGCCAATATTCTCGACCATGACATTACCTTCGGCGTTGGCCCGGCGGGTACGGGTAAAACCTACCTGGCAGTGGCTGCGGCAGTTGATGCCCTGGAGCGTCAGGAAATTCGCCGTATTCTGCTGACTCGTCCGGCAGTAGAAGCCGGTGAGAAACTGGGCTTCCTGCCTGGCGATTTAAGCCAGAAAGTAGACCCGTATCTGCGCCCGCTGTACGACGCGCTGTTTGAAATGCTGGGCTTTGAGAAAGTCGAGAAACTGATT------GAGCGCAACGTTATTGAAGTCGCACCGCTGGCCTATATGCGTGGTCGTACGCTGAACGACGCGTTTATCATTCTCGATGAGAGCCAGAACACCACCATCGAACAGATGAAGATGTTCCTGACCCGTATCGGTTTTAACTCAAAAGCGGTTATCACCGGCGACGTCACACAGATCGACCTGCCGCGTAATACTAAATCAGGCTTACGTCACGCCATCGAAGTGCTGGCCGATGTCGAAGAGATCAGCTTTAACTTCTTCCACAGCGAAGACGTGGTTCGTCACCCTGTGGTGGCGCGTATCGTTAACGCCTATGAA
TRN  11011101101011000
NAM  PHOL_SYNY3/110-314
ASQ  IVRAKTFRQRQYIKAIQKHDVTFCIGPAGTGKTFLAAVLAVQALLNNECDRLILTRPAVEAGEKLGFLPGDLQQKVDPFLRPLYDALYEFIEPEKIPDLM--ERGKIEVAPLAYMRGRTLTNAFVIVDEAQNTTPAQLKMVLTRLGFGSKMIVTGDITQTDLPNYQKSGLQVAQTILKDVEGVAFCYLNQADVVRHPLVQRIVEAYE
DSQ  ATTGTCCGGGCGAAAACGTTCCGGCAACGGCAATATATCAAGGCAATCCAAAAGCACGATGTGACGTTTTGCATTGGCCCAGCGGGCACAGGGAAAACTTTTTTGGCGGCGGTGCTTGCGGTCCAAGCGCTGCTAAACAATGAATGCGATCGCCTGATTTTGACTAGGCCGGCGGTGGAAGCGGGGGAAAAATTAGGTTTTCTGCCGGGGGATTTGCAACAAAAAGTTGATCCGTTTTTGCGACCCCTCTACGATGCTTTGTATGAATTTATTGAACCGGAAAAAATTCCTGACTTGATG------GAGCGGGGCAAAATTGAGGTAGCTCCCCTGGCCTATATGCGGGGCAGAACATTGACCAATGCCTTTGTGATTGTGGACGAGGCTCAAAATACCACCCCAGCCCAACTGAAAATGGTTTTAACTCGCCTGGGTTTTGGCTCGAAAATGATTGTGACCGGCGACATAACCCAAACCGATTTACCCAATTACCAAAAATCAGGTTTGCAAGTGGCCCAAACCATTCTTAAGGATGTGGAAGGGGTTGCATTCTGTTACCTCAATCAGGCGGATGTGGTGCGCCATCCCTTGGTGCAAAGGATTGTGGAAGCCTACGAA
TRN  10010101100011000
NAM  PHOH_ECOLI/148-354
ASQ  PILARNEAQLHYLKAIESKQLIFATGEAGCGKTWISAAKAAEALIHKDVDRIIVTRPVLQADEDLGFLPGDIAEKFAPYFRPVYDVLVRRLGASFMQYCLRPEIGKVEIAPFAYMRGRTFENAVVILDEAQNVTAAQMKMFLTRLGENVTVIVNGDITQCDLPRGVCSGLSDALERFEEDEMVGIVRFGKEDCVRSALCQRTLHAYS
DSQ  CCCATCCTCGCGCGAAATGAAGCGCAATTGCACTATCTGAAGGCTATTGAGAGTAAGCAGCTGATATTCGCCACGGGCGAAGCCGGGTGCGGAAAAACCTGGATCAGCGCAGCAAAAGCGGCAGAGGCCCTGATACATAAGGATGTCGACAGGATTATCGTCACCCGTCCAGTTCTGCAAGCCGATGAAGATCTTGGCTTCTTACCTGGAGATATCGCAGAAAAGTTTGCTCCCTATTTTCGCCCGGTCTACGACGTGCTGGTCCGGCGCTTAGGGGCTTCCTTTATGCAGTACTGCCTGCGACCGGAAATAGGGAAGGTGGAAATTGCGCCGTTCGCCTATATGCGTGGACGTACCTTTGAAAATGCAGTCGTCATTCTTGACGAGGCGCAGAATGTGACTGCCGCGCAAATGAAAATGTTTTTAACCCGCCTCGGGGAGAACGTGACGGTTATCGTCAACGGTGATATCACGCAATGCGATTTGCCTCGCGGCGTGTGCTCCGGATTAAGTGACGCGCTGGAACGTTTCGAAGAAGATGAAATGGTTGGGATCGTCCGGTTCGGTAAAGAGGACTGCGTACGTTCGGCACTTTGCCAACGTACGCTGCATGCCTACAGT
TRN  10010101100011010
//