EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02556 - SecB)
FAM  PF02556
PID  SecB
DES  Preprotein translocase subunit SecB
IPR  IPR003708
ANO  4
ALN  158
AID  0.302859
APH  ((Y357_METJA/1-143:1.68276,SECB_RICPR/1-152:0.79137):0.48166,SECB_HAEIN/1-155:0.28315,SECB_ECOLI/1-146:0.31402);
ATP  ((Y357_METJA/1-143,SECB_RICPR/1-152),SECB_HAEIN/1-155,SECB_ECOLI/1-146);
ATL  3.55296
DNO  4
DLN  474
DID  0.446147
DPH  ((Y357_METJA/1-143:0.85975,SECB_RICPR/1-152:0.65736):0.19282,SECB_HAEIN/1-155:0.18170,SECB_ECOLI/1-146:0.35232);
DTP  ((Y357_METJA/1-143,SECB_RICPR/1-152),SECB_HAEIN/1-155,SECB_ECOLI/1-146);
DTL  2.24395
RID  0.302859
RPH  ((Y357_METJA/1-143:1.68276,SECB_RICPR/1-152:0.79137):0.48166,SECB_HAEIN/1-155:0.28315,SECB_ECOLI/1-146:0.31402);
RTP  ((Y357_METJA/1-143,SECB_RICPR/1-152),SECB_HAEIN/1-155,SECB_ECOLI/1-146);
RTL  3.55296
LNK  SECB_ECOLI/1-146:P15040:M24489
LNK  SECB_HAEIN/1-155:P44853:U32758
LNK  SECB_RICPR/1-152:Q9ZE76:AJ235270
LNK  Y357_METJA/1-143:Q57803:U67489
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SECB_RICPR/1-152
ASQ  MSTINTDTS---EAMPHISVNAQYIKDLSLENPSAPSSLAALDQRPQIDLSLDINITNLSE-ENFYEVELNIEAIARNE--KYKLFQIELKYAGVFNLINIDSEQHPILLSVHCPAMIFPFARKIIASCTQDAGFQPLMIDPIDFGALYHKKMSEHQN
DSQ  ATGAGTACAATAAACACTGATACTAGT---------GAGGCAATGCCTCATATTTCTGTTAATGCACAATATATAAAAGATTTATCTCTTGAGAACCCTTCTGCACCGTCTTCTCTTGCGGCTTTAGATCAACGTCCTCAAATTGATTTATCGCTAGATATAAATATTACTAATTTATCGGAA---GAAAATTTCTATGAAGTAGAGTTAAATATTGAAGCAATTGCAAGAAATGAG------AAATATAAATTATTTCAGATAGAATTAAAATATGCTGGAGTATTTAATTTAATTAATATTGATTCTGAACAACATCCAATTTTATTATCTGTTCATTGCCCAGCAATGATATTTCCATTTGCTAGAAAAATTATAGCTAGTTGTACTCAAGATGCAGGATTCCAGCCTTTAATGATTGATCCTATTGATTTTGGAGCATTATATCATAAGAAAATGTCAGAGCATCAAAAT
TRN  10010101110011000
NAM  SECB_HAEIN/1-155
ASQ  MSEQKQDVAATEEQQPVLQIQRIYVKDVSFEAPNLP-HIFQQEWKPKLGFDLSTETTQVG--DDLYEVVLNISVETTLEDSGDVAFICEVKQAGVFTISGLEDVQMAHCLTSQCPNMLFPYARELVSNLVNRGTFPALNLSPVNFDALFVEYMNRQQA
DSQ  ATGTCAGAACAAAAACAAGACGTTGCAGCAACAGAAGAACAACAACCCGTTCTCCAAATTCAACGTATTTATGTGAAAGATGTGTCTTTTGAAGCTCCAAATCTTCCA---CATATTTTCCAACAAGAATGGAAACCAAAACTTGGTTTTGATTTAAGCACCGAAACAACCCAAGTTGGC------GATGACTTATATGAAGTGGTATTAAACATTTCTGTTGAAACTACACTTGAAGATAGTGGCGATGTCGCATTTATTTGCGAAGTTAAACAAGCAGGCGTATTTACTATTAGCGGTTTAGAAGATGTTCAAATGGCGCATTGTTTAACTTCTCAATGCCCGAATATGCTTTTCCCTTATGCGCGTGAATTAGTGTCTAACCTAGTAAATCGCGGTACGTTCCCTGCATTAAACTTATCTCCAGTAAACTTTGATGCATTGTTTGTTGAATATATGAATCGCCAACAAGCA
TRN  11011101111011000
NAM  SECB_ECOLI/1-146
ASQ  MSEQNN-------TEMTFQIQRIYTKDISFEAPNAP-HVFQKDWQPEVKLDLDTASSQLA--DDVYEVVLRVTVTASLG--EETAFLCEVQQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQAG
DSQ  ATGTCAGAACAAAACAAC---------------------ACTGAAATGACTTTCCAGATCCAACGTATTTATACCAAGGATATCTCTTTCGAAGCGCCGAACGCGCCG---CACGTTTTCCAGAAAGATTGGCAACCAGAAGTTAAACTTGATCTGGATACGGCATCTTCCCAACTGGCA------GATGACGTATACGAAGTGGTACTGCGTGTTACCGTAACGGCCTCTTTGGGC------GAAGAAACCGCGTTCCTGTGTGAAGTTCAGCAGGGCGGTATTTTCTCCATCGCGGGTATCGAAGGCACCCAGATGGCGCATTGCCTGGGAGCATACTGCCCGAACATTCTGTTCCCGTATGCTCGTGAGTGCATCACCAGCATGGTATCCCGCGGTACATTCCCGCAACTGAACCTTGCGCCGGTTAACTTCGATGCGCTGTTCATGAACTATTTGCAGCAGCAGGCTGGC
TRN  11011101101011001
NAM  Y357_METJA/1-143
ASQ  MEAPPK---------CALKFSNYIVKHIEFILNEVP----EKDEKIRLNVNIDTEIRYNKNEPNKFITIIKITAGEKKD-FAKSPVYLSVEVWGFFEVIEEAIDKVRQFAEINSVAILFPYVRALISTITANANIPPVILPPINVAGMMAN-IEEVKE
DSQ  ATGGAAGCTCCACCAAAG---------------------------TGTGCTTTAAAGTTTTCCAATTATATTGTTAAGCATATTGAATTTATACTAAATGAAGTCCCT------------GAAAAAGATGAAAAGATAAGGTTGAATGTAAATATTGATACAGAGATAAGATACAATAAAAATGAGCCAAATAAATTTATAACGATAATTAAAATAACAGCTGGGGAGAAAAAGGAT---TTTGCTAAAAGTCCAGTTTATTTGTCTGTTGAAGTATGGGGTTTCTTTGAAGTTATTGAGGAAGCGATTGATAAGGTTAGACAATTTGCAGAGATTAATTCTGTTGCAATATTATTCCCTTATGTTAGGGCTTTGATTTCAACTATTACGGCGAACGCTAATATTCCTCCGGTTATACTCCCACCTATAAATGTTGCTGGGATGATGGCAAAC---ATTGAAGAAGTAAAAGAA
TRN  10010101110011000
//