EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02548 - Pantoate_transf)
FAM  PF02548
PID  Pantoate_transf
DES  Ketopantoate hydroxymethyltransferase
IPR  IPR003700
ANO  8
ALN  268
AID  0.422226
APH  (((PANB_YEAST/24-291:0.83804,PANB_PYRHO/2-259:0.39887):0.12812,(((PANB_SYNY3/1-260:0.49543,PANB_MYCTU/19-278:0.43059):0.08520,PANB_ECOLI/2-260:0.51494):0.08243,PANB_BACSU/1-260:0.45249):0.10503):0.08758,PANB_HELPJ/9-266:0.47562,PANB_AQUAE/1-261:0.41096);
ATP  (((PANB_YEAST/24-291,PANB_PYRHO/2-259),(((PANB_SYNY3/1-260,PANB_MYCTU/19-278),PANB_ECOLI/2-260),PANB_BACSU/1-260)),PANB_HELPJ/9-266,PANB_AQUAE/1-261);
ATL  4.52697
DNO  8
DLN  804
DID  0.487702
DPH  (((PANB_PYRHO/2-259:0.33528,PANB_YEAST/24-291:0.58096):0.08113,PANB_HELPJ/9-266:0.41813):0.07104,(((PANB_MYCTU/19-278:0.40779,PANB_SYNY3/1-260:0.38623):0.09873,PANB_ECOLI/2-260:0.35845):0.09352,PANB_BACSU/1-260:0.36207):0.10697,PANB_AQUAE/1-261:0.35897);
DTP  (((PANB_PYRHO/2-259,PANB_YEAST/24-291),PANB_HELPJ/9-266),(((PANB_MYCTU/19-278,PANB_SYNY3/1-260),PANB_ECOLI/2-260),PANB_BACSU/1-260),PANB_AQUAE/1-261);
DTL  3.65927
RID  0.422226
RPH  (((PANB_YEAST/24-291:0.83804,PANB_PYRHO/2-259:0.39887):0.12812,(((PANB_SYNY3/1-260:0.49543,PANB_MYCTU/19-278:0.43059):0.08520,PANB_ECOLI/2-260:0.51494):0.08243,PANB_BACSU/1-260:0.45249):0.10503):0.08758,PANB_HELPJ/9-266:0.47562,PANB_AQUAE/1-261:0.41096);
RTP  (((PANB_YEAST/24-291,PANB_PYRHO/2-259),(((PANB_SYNY3/1-260,PANB_MYCTU/19-278),PANB_ECOLI/2-260),PANB_BACSU/1-260)),PANB_HELPJ/9-266,PANB_AQUAE/1-261);
RTL  4.52697
LNK  PANB_AQUAE/1-261:O67783:AE000766
LNK  PANB_BACSU/1-260:P52996:L47709
LNK  PANB_ECOLI/2-260:P31057:L17086
LNK  PANB_HELPJ/9-266:Q9ZM56:AE001471
LNK  PANB_MYCTU/19-278:Q10505:BX842579
LNK  PANB_PYRHO/2-259:O58665:AP000004
LNK  PANB_SYNY3/1-260:P52997:D64006
LNK  PANB_YEAST/24-291:P38122:Z36045
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  PANB_AQUAE/1-261
ASQ  MAINLQTLFKKKREGKKITMVSTYDYWSAKLCDEVGIDCILVGDSLGTVVKGEGDTLSVTLEEIIYHTKCVMRGVKNAFVIADMPFMSYQVSMEKAVENCGRVIKE-TKAKAVKLEGGE-----EIAELVYKLTRIGIPVVGHVGFTPQHINVFGKPKVVG-KKKEEEEKLRRDFRALEEAGAFMIVLESVPTHLAKELWKGSNSIVIGIGAGKYVDGQVLVFHDIVGLFEDFKPKFVRRYLEGAKLVKEALKNFKIDVEGGNFPSEE
DSQ  ATGGCGATAAACCTCCAGACTCTCTTCAAGAAGAAGAGAGAAGGGAAAAAGATTACCATGGTTTCTACCTACGATTACTGGAGTGCCAAACTCTGCGACGAGGTCGGGATAGACTGCATACTCGTCGGAGACTCCCTCGGAACTGTCGTAAAAGGTGAAGGGGATACGCTTTCAGTTACCTTGGAAGAAATCATTTATCACACAAAGTGCGTTATGAGAGGAGTAAAAAACGCCTTCGTTATAGCGGACATGCCCTTTATGAGTTATCAGGTTTCTATGGAAAAGGCGGTGGAAAACTGCGGAAGGGTTATAAAAGAG---ACTAAGGCAAAGGCTGTAAAGCTTGAGGGCGGGGAG---------------GAGATAGCGGAGCTCGTGTACAAATTAACGAGAATAGGAATACCTGTGGTGGGTCACGTTGGCTTTACACCCCAGCACATAAACGTCTTTGGAAAACCGAAGGTTGTGGGA---AAGAAAAAAGAAGAGGAGGAAAAACTAAGGAGAGATTTCAGAGCTCTGGAAGAGGCGGGAGCTTTTATGATCGTTCTTGAAAGCGTTCCCACACACTTGGCGAAAGAACTCTGGAAAGGTTCAAACTCTATAGTTATAGGAATAGGTGCGGGAAAGTACGTTGACGGACAAGTGCTCGTTTTTCACGATATAGTCGGTCTTTTTGAGGACTTTAAACCAAAGTTTGTGAGAAGGTACCTTGAAGGAGCTAAATTGGTAAAGGAAGCCCTTAAAAATTTTAAAATTGACGTGGAAGGGGGCAATTTCCCTTCGGAAGAG
TRN  10010101100011000
NAM  PANB_PYRHO/2-259
ASQ  REITPKRIREMKGK-EKITMITAYDYPSALLADKAGFDIVFIGDSLGMVVYGEPSTLNVTMEQMIFHTRAVAKAVKRALVLADMPFGSYEVSVEEGIKNAIKLVQA-G-ADAVKIEGGY-----DHRKLVKKLVRIGIPVMGHTGLTPQRYLRLGGYRIMG-GTEEEVEEILRDAKALEKAGAFAIVLEFVLADVAKLVTEEVSIPTIGIGSGPYVDGQVLVWHDVLGLYESSPP-FAKRYANLKEEILRAISTFREEVKEGKFPGRE
DSQ  AGAGAGATCACTCCAAAAAGAATAAGGGAGATGAAGGGAAAG---GAAAAGATAACCATGATAACAGCTTACGATTATCCTTCAGCGTTACTAGCGGATAAGGCCGGGTTCGATATAGTTTTCATTGGTGACTCCCTTGGTATGGTTGTTTATGGAGAACCAAGTACCCTTAACGTCACGATGGAGCAGATGATTTTCCATACTAGGGCCGTTGCTAAAGCCGTGAAGAGGGCCCTAGTTTTGGCCGATATGCCCTTTGGCAGTTACGAAGTTAGCGTTGAGGAGGGAATTAAGAACGCCATAAAGCTAGTTCAAGCT---GGG---GCCGATGCCGTTAAGATTGAAGGTGGCTAC---------------GATCATAGAAAGCTCGTTAAAAAACTCGTTAGGATCGGAATTCCAGTTATGGGACATACGGGATTAACTCCCCAGAGGTACCTAAGGCTTGGAGGTTATAGAATAATGGGG---GGAACTGAGGAGGAGGTTGAGGAGATACTCAGGGATGCAAAAGCTTTGGAAAAAGCTGGGGCATTTGCCATTGTTTTGGAGTTTGTCTTAGCGGATGTTGCTAAACTAGTGACGGAGGAAGTATCGATTCCAACGATAGGAATAGGATCAGGACCCTATGTGGATGGACAAGTCCTAGTTTGGCACGATGTCTTGGGTTTATATGAGAGTTCTCCACCT---TTTGCCAAGAGATATGCTAACCTGAAGGAAGAGATATTAAGGGCCATCTCAACCTTCAGGGAAGAGGTTAAGGAGGGGAAATTCCCAGGAAGAGAG
TRN  10010101100011000
NAM  PANB_HELPJ/9-266
ASQ  KKITLSHLQAKKNQ-EKIIAITAYDALFAQIFDPL-VDVILVGDSLNMSFFNQNDTLSASVKMMLYHTKAVCAGAKTPFIITDMPFGSYKD-EKTALKNAIRVYKE-TQASAIKLEGGK-----EKAKLVKTLTDEGVIVVGHIGLMPQFVRLDGGYKIKG-KNEEQQKKLLEDALSLEEAGVGLLVLEGITTPIAQTITQKIKIPTIGIGSGKDCDGQILVWSDMLGFFDSFKPKFVREYLKGKELIQNAIQQYADDVKKGNFPNEL
DSQ  AAAAAAATCACCCTTAGTCACCTCCAAGCTAAAAAAAATCAA---GAAAAAATCATCGCCATTACCGCTTATGACGCCCTATTCGCTCAAATATTTGATCCGCTA---GTGGATGTGATTTTAGTGGGCGATAGTTTGAATATGAGTTTTTTCAATCAAAACGACACTTTAAGCGCGAGTGTAAAAATGATGCTCTATCACACTAAAGCCGTGTGCGCGGGCGCTAAGACTCCTTTTATCATCACAGACATGCCCTTTGGAAGCTATAAAGAT---GAAAAAACAGCCCTAAAAAACGCCATCAGGGTTTATAAAGAA---ACCCAAGCGAGCGCGATCAAACTAGAGGGGGGGAAA---------------GAAAAAGCGAAACTGGTTAAAACGCTCACTGATGAGGGCGTTATCGTGGTAGGGCATATTGGCTTGATGCCTCAATTCGTGCGTCTTGATGGAGGCTATAAGATTAAGGGC---AAAAATGAAGAGCAACAAAAAAAGCTTTTAGAAGACGCGTTGAGTTTAGAAGAAGCTGGAGTGGGTTTGTTGGTTTTAGAGGGTATAACCACCCCTATCGCTCAAACAATCACGCAAAAAATCAAAATCCCCACGATCGGCATAGGGAGCGGCAAGGATTGCGACGGGCAGATTTTAGTGTGGAGCGATATGTTAGGCTTTTTTGATAGTTTTAAGCCTAAATTCGTGCGAGAATACCTTAAAGGGAAAGAATTGATTCAAAACGCGATTCAACAATACGCTGACGATGTGAAAAAGGGAAACTTCCCTAACGAATTA
TRN  10010101100011010
NAM  PANB_MYCTU/19-278
ASQ  TKIRTHHLQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPISIDELIPLVRGVVRGAPHALVVADLPFGSYEAGPTAALAAATRFLKD-GGAHAVKLEGGE-----RVAEQIACLTAAGIPVMAHIGFTPQSVNTLGGFRVQG-RGDA-AEQTIADAIAVAEAGAFAVVMEMVPAELATQITGKLTIPTVGIGAGPNCDGQVLVWQDMAGFSGAKTARFVKRYADVGGELRRAAMQYAQEVAGGVFPADE
DSQ  ACCAAGATCCGCACCCACCACCTACAGAGATGGAAGGCCGACGGCCACAAGTGGGCCATGCTGACGGCCTACGACTATTCGACGGCCCGGATCTTCGACGAGGCCGGCATCCCGGTGCTGCTGGTCGGTGATTCGGCGGCCAACGTCGTGTACGGCTACGACACCACCGTGCCGATCTCCATCGACGAGCTGATCCCGCTGGTCCGTGGCGTGGTGCGGGGTGCCCCGCACGCACTGGTCGTCGCCGACCTGCCGTTCGGCAGCTACGAGGCGGGGCCCACCGCCGCGTTGGCCGCCGCCACCCGGTTCCTCAAGGAC---GGCGGCGCACATGCGGTCAAGCTCGAGGGCGGTGAG---------------CGGGTGGCCGAGCAAATCGCCTGTCTGACCGCGGCGGGCATCCCGGTGATGGCACACATCGGCTTCACCCCGCAAAGCGTCAACACCTTGGGCGGCTTCCGGGTGCAGGGC---CGCGGCGACGCC---GCCGAACAAACCATCGCCGACGCGATCGCCGTCGCCGAAGCCGGAGCGTTTGCCGTCGTGATGGAGATGGTGCCCGCCGAGTTGGCCACCCAGATCACCGGCAAGCTTACCATTCCGACGGTCGGGATCGGCGCTGGGCCCAACTGCGACGGCCAGGTCCTGGTATGGCAGGACATGGCCGGGTTCAGCGGCGCCAAGACCGCCCGCTTCGTCAAACGGTATGCCGATGTCGGTGGTGAACTACGCCGTGCTGCAATGCAATACGCCCAAGAGGTGGCCGGCGGGGTATTCCCCGCTGACGAA
TRN  10010101100011011
NAM  PANB_SYNY3/1-260
ASQ  MAITPTQLLDWKRQQRPIVALTAWDTAIASVLDAAGVEIILVGDSLGMVALGYETTLPVSLDTMIHHTAAVKRGVQRALVVCDLPFLTYQESPAQAMGSAGRVLQE-TGAQAVKLEGGHP----RMVETVARLTEVGIPVMGHVGLTPQSVHQLG-YRQQG-QDPATAEKILHQAIALAEAGVFAIVLEHIPSELAASITEQLPIPTIGIGAGPQCDGQVLVTADLLGLT-VKQPPFAPAYLNLRHTITETVHKFSGEVRQRQFPRRG
DSQ  ATGGCCATTACCCCCACCCAATTGTTGGATTGGAAGCGTCAACAACGGCCTATTGTGGCCCTTACTGCCTGGGATACGGCGATCGCCTCGGTGTTGGATGCGGCGGGAGTGGAAATTATTCTGGTGGGGGATTCCCTCGGAATGGTGGCTTTGGGCTACGAAACTACCCTACCGGTGAGCTTGGACACCATGATTCACCACACAGCGGCAGTTAAAAGGGGAGTACAAAGAGCCTTGGTGGTCTGTGACCTGCCCTTTTTGACCTATCAGGAAAGTCCAGCCCAGGCCATGGGGTCAGCGGGAAGGGTTTTGCAGGAA---ACCGGTGCCCAGGCAGTGAAATTAGAAGGGGGTCACCCC------------CGCATGGTGGAAACCGTAGCTCGACTAACGGAGGTGGGCATTCCGGTGATGGGTCATGTGGGCTTAACGCCCCAATCAGTCCATCAGTTGGGT---TATCGGCAACAGGGC---CAGGACCCGGCCACAGCGGAGAAAATTCTTCATCAGGCGATCGCCTTGGCAGAGGCGGGAGTGTTTGCCATTGTTTTAGAACATATTCCTAGCGAACTAGCGGCTAGTATCACTGAGCAGTTGCCCATTCCCACCATTGGCATTGGGGCAGGGCCCCAGTGTGACGGCCAGGTTTTGGTGACGGCGGATTTACTCGGTTTGACA---GTCAAACAACCGCCCTTTGCTCCGGCCTATCTGAATTTACGACATACCATTACGGAAACAGTGCATAAATTCAGTGGAGAAGTGCGACAAAGACAATTTCCCCGGCGGGGT
TRN  10010101100011000
NAM  PANB_ECOLI/2-260
ASQ  KPTTISLLQKYKQEKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTAAVRRGAPNCLLLADLPFMAYAT-PEQAFENAATVMRA-G-ANMVKIEGGE-----WLVETVQMLTERAVPVCGHLGLTPQSVNIFGGYKVQG-RGDEAGDQLLSDALALEAAGAQLLVLECVPVELAKRITEALAIPVIGIGAGNVTDGQILVMHDAFGITGGHIPKFAKNFLAETGDIRAAVRQYMAEVESGVYPGEE
DSQ  AAACCGACCACCATCTCCTTACTGCAGAAGTACAAACAGGAAAAAAAACGTTTCGCGACCATCACCGCTTATGACTATAGCTTCGCCAAACTCTTTGCTGATGAAGGGCTTAACGTCATGCTGGTGGGCGATTCGCTGGGCATGACGGTTCAGGGGCACGACTCCACCCTGCCAGTTACCGTTGCCGATATCGCCTACCACACTGCCGCCGTACGTCGCGGCGCACCAAACTGCCTGCTGCTGGCTGACCTGCCGTTTATGGCGTATGCCACG---CCGGAACAAGCCTTCGAAAACGCCGCAACGGTTATGCGTGCC---GGT---GCTAACATGGTCAAAATTGAAGGCGGTGAG---------------TGGCTGGTAGAAACCGTACAAATGCTGACCGAACGTGCCGTTCCTGTATGTGGTCACTTAGGTTTAACACCACAGTCAGTGAATATTTTCGGTGGCTACAAAGTTCAGGGG---CGCGGCGATGAAGCGGGCGATCAACTGCTCAGCGATGCATTAGCCTTAGAAGCTGCTGGGGCACAGCTGCTGGTGCTGGAATGCGTGCCGGTTGAACTGGCAAAACGTATTACCGAAGCACTGGCGATCCCGGTTATTGGCATTGGCGCAGGCAACGTCACTGACGGGCAGATCCTCGTGATGCACGACGCCTTTGGTATTACCGGCGGTCACATTCCTAAATTCGCTAAAAATTTCCTCGCCGAAACGGGCGACATCCGCGCGGCTGTGCGGCAGTATATGGCTGAAGTGGAGTCCGGCGTTTATCCGGGCGAAGAA
TRN  11011101101011000
NAM  PANB_BACSU/1-260
ASQ  MKTKLDFLKMKESE-EPIVMLTAYDYPAAKLAEQAGVDMILVGDSLGMVVLGLDSTVGVTVADMIHHTKAVKRGAPNTFIVTDMPFMSYHLSKEDTLKNAAAIVQE-SGADALKLEGGE-----GVFESIRALTLGGIPVVSHLGLTPQSVGVLGGYKVQG-KDEQSAKKLIEDSIKCEEAGAMMLVLECVPAELTAKIAETLSIPVIGIGAGVKADGQVLVYHDIIGHGVERTPKFVKQYTRIDETIETAISGYVQDVRHRAFPEQK
DSQ  ATGAAAACAAAACTGGATTTTCTAAAAATGAAGGAGTCTGAA---GAACCGATTGTCATGCTGACCGCTTATGATTATCCGGCAGCTAAACTTGCTGAACAAGCGGGAGTTGACATGATTTTAGTCGGTGATTCACTTGGAATGGTCGTCCTCGGCCTTGATTCAACTGTCGGTGTGACAGTTGCGGACATGATCCATCATACAAAAGCCGTTAAAAGGGGTGCGCCGAATACCTTTATTGTGACAGATATGCCGTTTATGTCTTATCACCTGTCTAAGGAAGATACGCTGAAAAATGCAGCGGCTATCGTTCAGGAA---AGCGGAGCTGACGCACTGAAGCTTGAGGGCGGAGAA---------------GGCGTGTTTGAATCCATTCGCGCATTGACGCTTGGAGGCATTCCAGTAGTCAGTCACTTAGGTTTGACACCGCAGTCAGTCGGCGTACTGGGCGGCTATAAAGTACAGGGC---AAAGACGAACAAAGCGCCAAAAAATTAATAGAAGACAGTATAAAATGCGAAGAAGCAGGAGCTATGATGCTTGTGCTGGAATGTGTGCCGGCAGAACTCACAGCCAAAATTGCCGAGACGCTAAGCATACCGGTCATTGGAATCGGGGCTGGTGTGAAAGCGGACGGACAAGTTCTCGTTTATCATGATATTATCGGCCACGGTGTTGAGAGAACACCTAAATTTGTAAAGCAATATACGCGCATTGATGAAACCATCGAAACAGCAATCAGCGGATATGTTCAGGATGTAAGACATCGTGCTTTCCCTGAACAAAAG
TRN  10010101100011000
NAM  PANB_YEAST/24-291
ASQ  KYNTIQDIRNKYFTGTPLSMCTAYDFITATWVNKANCDLLLVGDSLAMTSLGYDSTITLSLNEFKYHVASVCRAEGSSMVVVDMPFGTFESGISDGLKNAIDIMKLDSKVTSVKVEVGSYTKDKYAMKFIEELCSRGIPVMAHIGLTPQKVHSLGGYKVQGSKSLLQMQELYETAMQLQKIGCWSILIECVPHKMAQFITSKLSVPTIGIGAGNGTSGQVLVISDLLGMQGDSVPKFVKQAVNMTDIATQGLKEYIASVEDRTFPERG
DSQ  AAATATAATACGATTCAGGATATCAGGAACAAATATTTTACTGGTACGCCTTTGTCGATGTGTACTGCGTATGACTTCATTACTGCAACATGGGTTAACAAGGCTAATTGTGATTTACTCTTAGTCGGAGATTCTTTGGCGATGACTTCATTGGGGTACGATAGCACAATTACACTATCCTTGAATGAGTTTAAATATCATGTTGCCTCTGTGTGCAGAGCTGAAGGTTCTTCCATGGTAGTGGTAGACATGCCATTCGGTACGTTTGAATCGGGCATATCTGATGGCTTGAAGAATGCCATAGATATCATGAAATTGGACAGTAAAGTCACCTCAGTCAAAGTTGAAGTCGGTTCTTACACCAAAGACAAATATGCAATGAAATTTATTGAAGAACTGTGCTCCCGGGGTATACCTGTTATGGCTCATATAGGACTAACTCCCCAAAAAGTTCATTCACTTGGAGGTTATAAAGTGCAAGGTAGCAAAAGTCTATTACAAATGCAGGAGCTGTATGAAACCGCCATGCAACTACAAAAAATTGGCTGTTGGTCTATCCTGATTGAATGTGTCCCCCATAAGATGGCTCAGTTCATAACATCTAAACTCTCAGTACCAACAATAGGTATCGGTGCAGGTAACGGTACCAGTGGACAAGTTCTAGTTATATCTGACCTTCTCGGGATGCAAGGCGATTCTGTCCCAAAATTTGTGAAGCAAGCTGTAAATATGACAGATATTGCCACTCAGGGCTTGAAGGAGTACATTGCAAGTGTAGAGGATAGGACATTTCCTGAGAGAGGT
TRN  10010101100011000
//