EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02499 - DNA_pack_C)
FAM  PF02499
PID  DNA_pack_C
DES  Probable DNA packing protein, C-terminus
IPR  IPR003498
ANO  13
ALN  374
AID  0.470914
APH  (((((((VTER_SHV21/333-680:0.21346,(O40928_HHV8/337-684:0.22835,Q66632_9GAMA/1-348:0.22770):0.07093):0.07801,VTER_EBV/342-689:0.32423):0.04304,O36378_9GAMA/336-680:0.33383):0.11936,O41945_MHV68/1-345:0.42473):0.37307,(((Q65567_9ALPH/371-728:0.28937,VTER_EHV1B/374-731:0.12511):0.12259,VTER_VZVD/382-746:0.30152):0.06841,VTER_HHV11/373-731:0.15372):0.46594):0.25633,VTER_HCMVA/326-674:0.27615):0.22387,VTER_HHV6U/322-667:0.09976,VTER_HHV7J/318-663:0.17128);
ATP  (((((((VTER_SHV21/333-680,(O40928_HHV8/337-684,Q66632_9GAMA/1-348)),VTER_EBV/342-689),O36378_9GAMA/336-680),O41945_MHV68/1-345),(((Q65567_9ALPH/371-728,VTER_EHV1B/374-731),VTER_VZVD/382-746),VTER_HHV11/373-731)),VTER_HCMVA/326-674),VTER_HHV6U/322-667,VTER_HHV7J/318-663);
ATL  4.99119
DNO  10
DLN  1122
DID  0.529455
DPH  (((((((O41945_MHV68/1-345:0.40123,(O36378_9GAMA/336-680:0.29508,VTER_SHV21/333-680:0.28112):0.05886):0.10774,O40928_HHV8/337-684:0.21125):0.08857,Q66632_9GAMA/1-348:0.16494):0.05880,VTER_EBV/342-689:0.23221):0.25660,VTER_HCMVA/326-674:0.30605):0.25693,Q65567_9ALPH/371-728:0.20692):0.08452,VTER_HHV11/373-731:0.16668,VTER_VZVD/382-746:0.44274);
DTP  (((((((O41945_MHV68/1-345,(O36378_9GAMA/336-680,VTER_SHV21/333-680)),O40928_HHV8/337-684),Q66632_9GAMA/1-348),VTER_EBV/342-689),VTER_HCMVA/326-674),Q65567_9ALPH/371-728),VTER_HHV11/373-731,VTER_VZVD/382-746);
DTL  3.62024
RID  0.474169
RPH  (VTER_VZVD/382-746:0.32171,(((O41945_MHV68/1-345:0.43221,(VTER_EBV/342-689:0.29463,(O36378_9GAMA/336-680:0.35059,((O40928_HHV8/337-684:0.23049,Q66632_9GAMA/1-348:0.22552):0.07238,VTER_SHV21/333-680:0.20630):0.07818):0.05020):0.11170):0.38720,VTER_HCMVA/326-674:0.43361):0.42870,Q65567_9ALPH/371-728:0.29866):0.08731,VTER_HHV11/373-731:0.17877);
RTP  (VTER_VZVD/382-746,(((O41945_MHV68/1-345,(VTER_EBV/342-689,(O36378_9GAMA/336-680,((O40928_HHV8/337-684,Q66632_9GAMA/1-348),VTER_SHV21/333-680)))),VTER_HCMVA/326-674),Q65567_9ALPH/371-728),VTER_HHV11/373-731);
RTL  4.18816
LNK  O36378_9GAMA/336-680:O36378:AF005370
LNK  O40928_HHV8/337-684:O40928:U93872
LNK  O41945_MHV68/1-345:O41945:U97553
LNK  Q65567_9ALPH/371-728:Q65567:Z48053
LNK  Q66632_9GAMA/1-348:Q66632:U20824
LNK  VTER_EBV/342-689:P03219:V01555
LNK  VTER_EHV1B/374-731:P28969:
LNK  VTER_HCMVA/326-674:P16732:X17403
LNK  VTER_HHV11/373-731:P04295:X14112
LNK  VTER_HHV6U/322-667:P24443:
LNK  VTER_HHV7J/318-663:P52462:
LNK  VTER_SHV21/333-680:Q01020:X64346
LNK  VTER_VZVD/382-746:P09294:X04370
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.........xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.........xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VTER_VZVD/382-746
ASQ  LNQTNCKIIFVSSTNTGKASTSFLYNLRGSSDQLLNVVTYVCDDHMPRVLAHSDVTACSCYVLNKPVFITMDGAMRRTADLFMADSFVQEIVGGRKQnsgGVGFDRP--LFTKTARERFILYRPSTVA--NCAILSSVLYVYVDPAFTSNTRASGTGVAIVGRYKSD---WIIFGLEHFFLRALTGTSSSEIGRCVTQCLGHILALHPNTFTNVHVSIEGNSSQDSAVAISLAIAQQFAVLEKGNVLSSAP.-VLLFYHSIPPGCSVAYPFFLLQKQKTPAVDYFVKRFNSGNIIASQELVSLTVKLGVDPVEYLCKQLDNLTEVIKGgmgNLDTKTYTGKgTTGTMSDDLMVALIMSVYIGSSCIPDSVFMPI
DSQ  TTAAATCAAACCAATTGTAAAATTATTTTTGTTTCATCAACAAATACCGGAAAAGCAAGTACAAGTTTTTTGTATAACTTACGTGGATCGTCGGATCAGTTGTTAAACGTTGTTACATATGTATGCGACGATCACATGCCGCGTGTTTTAGCACATAGCGATGTCACAGCTTGTTCGTGTTATGTATTAAATAAGCCGGTTTTCATCACAATGGATGGAGCCATGCGGCGCACTGCAGATTTATTTATGGCCGACTCCTTCGTGCAGGAAATTGTAGGTGGGCGTAAACAGaattctgggGGTGTGGGGTTTGACCGGCCA------TTATTTACAAAAACTGCCCGTGAGAGGTTTATTTTATATCGGCCGTCAACCGTTGCG------AATTGTGCTATATTATCGTCAGTGTTGTACGTTTACGTAGACCCTGCATTTACCTCAAATACACGAGCGTCTGGTACTGGTGTAGCGATTGTTGGTCGTTATAAGTCGGAT---------TGGATTATATTTGGATTGGAGCACTTTTTTCTTAGAGCTTTAACTGGCACGTCTTCCAGTGAGATAGGGCGTTGCGTTACTCAATGCTTAGGCCACATACTCGCTTTACACCCCAATACATTTACAAACGTACACGTTTCTATAGAGGGAAACAGCAGCCAGGATTCTGCAGTTGCCATATCGTTGGCTATAGCACAACAGTTTGCTGTCCTCGAAAAGGGAAACGTGCTATCTTCCGCTCCA...---GTGTTACTGTTTTATCATTCCATACCTCCCGGATGTAGCGTGGCGTACCCTTTTTTTTTATTACAAAAACAAAAAACGCCGGCCGTAGACTATTTTGTTAAACGATTTAACTCCGGAAATATAATAGCCTCACAGGAGCTTGTATCCCTAACAGTAAAGTTAGGTGTAGACCCCGTGGAGTATCTATGTAAACAGTTGGATAACCTGACAGAGGTAATTAAAGGCggtatgggtAATCTAGACACAAAAACTTACACGGGTAAAggtACCACGGGAACAATGTCAGATGATCTGATGGTTGCATTAATTATGTCCGTGTATATTGGCAGTTCATGTATACCGGATTCCGTGTTTATGCCTATT
TRN  10010101100011000
NAM  VTER_EHV1B/374-731
ASQ  LNQTNCKIIFVSSTNTGKASTSFLYNLKGAADDLLNVVTYICDEHMERVKAHTNATACSCYILNKPVFITMDGAMRNTAELFLPDSFMQEIIGGGNVs..GAHRDEP--VFTKTAQDRFLLYRPSTVA--NQDIMSSDLYVYVDPAFTTNAMASGTGVAVVGRYRSN---WVVFGMEHFFLSALTGSSAELIARCVAQCLAQVFAIHKRPFDSVRVAVEGNSSQDAAVAIATNIQLELNTLRRADVVPMPG.-AVLFYHCTPHGSSVAYPFFLLQKQKTGAFDHFIKAFNSGSVLASQELVSNTVRLQTDPVEYLLTQMKNLTEVVTG...TSETRVFTGK.-RNGASDDMLVALVMAVYLSSLPPTSDAFSSL
NAM  Q65567_9ALPH/371-728
ASQ  LNQASCKIIFVSSTNTGKASTSFLYNLKGASDGLLNVVTYICNEHTPRVAAHGGATACSCYVLNKPVFITMDAAARNTAETFLPNSFMQEIIGGGEV...-ARRAEPAAVFTRAAGEQFLLYRPSTAA--ARGPWPERLYMYIDPAFTSNARASGSGIAVVGRHRGS---WLVLGLEHFFLPALTGSSAAEIARCAVRCFAQVMAVHRRRLDGLFVAVEGNSSQDSAVAIALGVRRELDSLAASGAVPMPA.-ETRFYHCRPPGSAVAYPFFLLQKQKTAAFDHFIRLFNSGRVVASQDLASLTVRLQTDPVEYLFEQLQNLTESTAG...PGGARAFSGK.-RRGAADDLMVALVMAVFVGSLPPTDGAFCPL
DSQ  CTGAACCAGGCCAGCTGCAAGATAATCTTCGTCTCCTCGACCAACACCGGCAAGGCCAGCACGAGCTTCCTCTACAACCTCAAGGGCGCCTCTGACGGGCTGCTCAACGTGGTGACGTATATATGCAACGAGCACACGCCGCGTGTGGCGGCGCACGGCGGCGCCACCGCGTGCTCGTGTTACGTCCTCAACAAGCCCGTCTTCATCACCATGGACGCCGCCGCGCGCAACACCGCCGAGACCTTCCTGCCCAACTCGTTCATGCAGGAGATCATTGGCGGCGGCGAGGTC.........---GCGCGCCGCGCCGAGCCCGCGGCCGTGTTCACCCGCGCGGCGGGCGAGCAGTTTCTGCTCTATCGGCCATCCACGGCGGCG------GCCCGCGGCCCGTGGCCCGAGCGGCTCTACATGTACATCGACCCGGCCTTCACGAGCAACGCCCGCGCCTCCGGCTCCGGCATCGCCGTCGTGGGGCGGCATCGCGGCAGC---------TGGCTGGTGCTGGGCCTGGAGCACTTTTTTTTGCCGGCGCTCACGGGCAGCTCGGCCGCCGAGATCGCGCGGTGCGCCGTGCGCTGCTTCGCGCAGGTCATGGCCGTGCACCGGCGCCGCCTCGACGGCCTCTTTGTCGCCGTCGAGGGCAACAGCAGCCAGGACTCCGCGGTCGCGATCGCGCTCGGCGTCCGGCGCGAGCTCGACTCGCTGGCCGCGTCCGGTGCCGTGCCCATGCCCGCC...---GAGACGCGCTTTTACCACTGCCGCCCGCCCGGGAGCGCGGTGGCCTACCCCTTTTTTTTGCTGCAGAAGCAGAAGACGGCCGCCTTTGACCACTTCATCCGCTTATTCAACTCCGGGCGCGTGGTTGCCTCCCAGGACCTGGCCTCGCTGACCGTGCGCCTGCAGACAGACCCCGTGGAGTACCTCTTTGAGCAACTGCAAAACCTAACCGAGAGCACCGCCGGC.........CCCGGCGGGGCCCGGGCCTTCTCGGGCAAG...---CGCCGGGGCGCCGCCGACGATCTAATGGTGGCGCTAGTGATGGCCGTGTTCGTGGGCAGCCTCCCGCCCACCGACGGCGCCTTCTGCCCGCTG
TRN  10010111100111010
NAM  VTER_HHV11/373-731
ASQ  LNQANCKIIFVSSTNTGKASTSFLYNLRGAADELLNVVTYICDDHMPRVVTHTNATACSCYILNKPVFITMDGAVRRTADLFLADSFMQEIIGGQAR...ETGDDRP--VLTKSAGERFLLYRPSTTT--NSGLMAPDLYVYVDPAFTANTRASGTGVAVVGRYRDD---YIIFALEHFFLRALTGSAPADIARCVVHSLTQVLALHPGAFRGVRVAVEGNSSQDSAVAIATHVHTEMHRLLASEGADAGSgPELLFYHCEPPGSAVLYPFFLLNKQKTPAFEHFIKKFNSGGVMASQEIVSATVRLQTDPVEYLLEQLNNLTETVSP...NTDVRTYSGK.-RNGASDDLMVAVIMAIYLAAQAGPPHTFAPI
DSQ  CTCAACCAGGCCAACTGCAAGATTATCTTCGTGTCGTCCACCAACACCGGGAAGGCCAGTACGAGCTTTTTGTACAACCTCCGCGGGGCCGCAGACGAGCTTCTCAACGTGGTGACCTATATATGCGATGATCACATGCCGAGGGTGGTGACGCACACAAACGCCACGGCCTGTTCTTGTTATATCCTCAACAAGCCCGTTTTCATCACGATGGACGGGGCGGTTCGCCGGACCGCCGATTTGTTTCTGGCCGATTCCTTCATGCAGGAGATCATCGGGGGCCAGGCCAGG.........GAGACCGGCGACGACCGGCCC------GTTCTGACCAAGTCTGCGGGGGAGCGGTTTCTGTTGTACCGCCCCTCGACCACCACC------AACAGCGGCCTCATGGCCCCCGATTTGTACGTGTACGTGGATCCCGCGTTCACGGCCAACACCCGAGCCTCCGGGACCGGCGTCGCTGTCGTCGGGCGGTACCGCGACGAT---------TATATCATCTTCGCCCTGGAGCACTTTTTTCTCCGCGCGCTCACGGGCTCGGCCCCCGCCGACATCGCCCGCTGCGTCGTCCACAGTCTGACGCAGGTCCTGGCCCTGCATCCCGGGGCGTTTCGCGGCGTCCGGGTGGCGGTCGAGGGAAATAGCAGCCAGGACTCGGCCGTCGCCATCGCCACGCACGTGCACACAGAGATGCACCGCCTACTGGCCTCGGAGGGGGCCGACGCGGGCTCGggcCCCGAGCTTCTCTTCTACCACTGCGAGCCTCCCGGGAGCGCGGTGCTGTACCCCTTTTTCCTGCTCAACAAACAGAAGACGCCCGCCTTTGAACACTTTATTAAAAAGTTTAACTCCGGGGGCGTCATGGCCTCCCAGGAGATCGTTTCCGCGACGGTGCGCCTGCAGACCGACCCGGTCGAGTATCTGCTCGAGCAGCTAAATAACCTCACCGAAACCGTCTCCCCC.........AACACTGACGTCCGTACGTATTCCGGAAAA...---CGGAACGGCGCCTCGGATGACCTTATGGTCGCCGTCATTATGGCCATCTACCTCGCGGCCCAGGCCGGACCTCCGCACACATTCGCTCCTATC
TRN  10010101100011011
NAM  VTER_HHV7J/318-663
ASQ  LPQSSTKIIFISSTNSGNHSTSFLTKLSNSPFEMLTVVSYVCEDHVHILNDRGNATTCACYRLHKPKFISINADVKKTADLFLEGAFKHEIMGGSLC...NVVND--TLIT-EQGLIEFDLFRYSTISKQIIPFLGKELYIYIDPAYTINRRASGTGVAAIGTYGDQ---YIIYGMEHYFLESLLSNSDASIAECASHMILAVLELHP-FFTELKIIIEGNSNQSSAVKIACILKQTISVIRY--------.KHITFFHTLDQS-QIAQPFYLLGREKRLAVEYFISNFNSGYIKASQELISFTIKITYDPIEYVIEQIKNLHQININ...EHVT--YNAK.KQT-CSDDLLISIIMAIYMCHEGKQ-TSFKEI
NAM  VTER_HHV6U/322-667
ASQ  LPQASTKILFISSTNSGNHSTSFLMKLNNSPFEMLSVVSYVCEDHAHMLNERGNATACSCYRLHKPKFISINAEVKKTANLFLEGAFIHEIMGGATC...NVIND--VLIT-EQGQTEFEFFRYSTINKNLIPFLGKDLYVYLDPAYTGNRRASGTGIAAIGTYLDQ---YIVYGMEHYFLESLMTSSDTAIAECAAHMILSILDLHP-FFTEVKIIIEGNSNQASAVKIACIIKENITANKS--------.IQVTFFHTPDQN-QIAQPFYLLGKEKKLAVEFFISNFNSGNIKASQELISFTIKITYDPVEYALEQIRNIHQISVN...NYIT--YSAK.KQA-CSDDLIIAIIMAIYVCSGNSS-ASFREI
NAM  VTER_HCMVA/326-674
ASQ  LAQNTTKIIFISSTNTTSDSTCFLTRLNNAPFDMLNVVSYVCEEHLHSFTEKGDATACPCYRLHKPTFISLNSQVRKTANMFMPGAFMDEIIGGTNK...ISQNT--VLIT-DQSREEFDILRYSTLNTNAYDYFGKTLYVYLDPAFTTNRKASGTGVAAVGAYRHQ---FLIYGLEHFFLRDLSESSEVAIAECAAHMIISVLSLHP-YLDELRIAVEGNTNQAAAVRIACLIRQSVQSSTL--------.IRVLFYHTPDQN-HIEQPFYLMGRDKALAVEQFISRFNSGYIKASQELVSYTIKLSHDPIEYLLEQIQNLHRVTLA...EGTTARYSAK.RQNRISDDLIIAVIMATYLCDDIHA-IRFRVS
DSQ  CTGGCCCAGAATACCACCAAGATCATCTTCATATCGTCCACCAACACTACCAGTGACTCCACGTGTTTCTTGACGCGCCTTAACAATGCGCCCTTTGACATGCTCAACGTGGTCTCTTACGTGTGCGAAGAGCACCTGCACAGCTTCACGGAGAAGGGCGACGCCACGGCGTGTCCTTGCTACCGACTGCACAAGCCCACCTTCATCAGCCTCAACTCGCAAGTGCGCAAGACGGCCAACATGTTTATGCCGGGCGCTTTCATGGACGAGATCATCGGCGGTACCAATAAA.........ATCTCGCAGAACACC------GTGCTCATCACG---GACCAGAGCCGCGAAGAGTTCGATATTTTGCGTTACAGCACGCTCAACACCAACGCCTACGATTATTTCGGCAAGACGCTTTACGTGTATCTGGACCCGGCCTTCACCACCAACCGCAAGGCCTCGGGCACGGGCGTGGCGGCCGTAGGCGCCTACCGACACCAG---------TTTCTCATTTACGGCCTAGAGCATTTCTTTTTGCGCGACCTCTCCGAGAGTTCTGAGGTAGCCATCGCCGAGTGCGCGGCGCACATGATCATCTCGGTGCTGAGCCTGCACCCT---TACCTGGACGAACTGCGCATCGCCGTGGAGGGCAACACCAACCAGGCGGCGGCCGTGCGCATCGCCTGCCTCATCCGACAGAGCGTGCAGAGCAGCACGCTC------------------------...ATCCGCGTGCTCTTCTACCACACGCCCGACCAGAAC---CACATCGAACAGCCCTTCTACCTCATGGGCCGCGACAAGGCGCTGGCCGTGGAACAGTTCATCTCGCGTTTCAACTCGGGCTACATCAAAGCCTCGCAAGAGCTCGTCTCCTACACCATCAAGCTGAGCCACGACCCCATCGAGTATCTTCTGGAGCAGATTCAGAACCTGCACCGCGTCACGCTGGCC.........GAAGGCACGACGGCGCGTTACTCGGCCAAG...CGCCAGAATCGTATCTCGGACGATCTTATCATCGCCGTCATCATGGCCACCTACCTGTGTGACGATATACACGCC---ATCCGTTTCAGGGTCAGC
TRN  10010101100011011
NAM  VTER_SHV21/333-680
ASQ  MLQKDAKLIFISSVNSGDRATSFLFNLKNASEKMLNIVNYICPDHKDDFSLQDSLISCPCYKLYIPTYITIDETIKNTTNLFLDGAFTTELMGDMSG...ISKSN-MHKVISEMAITQFDLCRADTTKPEITQCLNSTMYIYIDPAYTNNSEASGTGIGAILTFKNNSSKCIIVGMEHYFLKDLTGTATYQIASCACSLIRASLVLYP-HIQCVHVAVEGNSSQDSAVAISTLINECSP------------.IKVYFIHYKDKTTTMQWPIYMLGAEKSIAFESFIYAINSGTISASQSIISNTIKLSFDPISYLIEQIRSIRCYPLR...DGSHT-YCAK.KRT-VSDDVLVAVVMAYFFATSNK--HIFKPL
DSQ  ATGCTACAAAAAGATGCTAAGCTGATATTTATATCATCAGTTAATTCAGGAGACAGAGCTACTAGTTTTTTATTTAATTTAAAAAATGCTTCTGAAAAAATGTTAAACATAGTTAACTATATTTGTCCTGACCACAAAGATGATTTTAGTTTACAAGATTCATTAATTTCTTGCCCGTGTTATAAACTGTACATTCCGACATACATAACTATTGATGAGACTATCAAAAATACTACAAATCTCTTCTTAGATGGTGCTTTTACTACAGAACTAATGGGAGACATGTCTGGT.........ATTTCAAAAAGTAAC---ATGCACAAAGTTATTAGCGAGATGGCTATAACTCAATTTGATCTATGTAGGGCAGATACAACTAAGCCAGAAATAACTCAATGCTTAAACTCAACAATGTACATATATATAGATCCTGCTTATACAAACAACTCAGAAGCATCTGGCACTGGAATAGGAGCTATATTGACTTTTAAAAACAACTCTAGCAAATGTATAATTGTTGGGATGGAGCATTATTTTTTGAAAGACTTGACTGGGACAGCTACTTATCAAATAGCATCTTGTGCATGTTCTCTTATAAGAGCATCTTTAGTGCTGTATCCT---CATATACAGTGTGTACATGTAGCTGTTGAAGGAAACAGCAGCCAAGACTCAGCAGTTGCAATTTCTACACTTATAAACGAATGTTCTCCA------------------------------------...ATTAAAGTCTACTTTATCCATTATAAAGATAAAACGACTACAATGCAGTGGCCAATATATATGCTAGGAGCAGAAAAATCTATAGCATTTGAGTCTTTCATATATGCTATAAACTCTGGAACTATAAGTGCTAGCCAAAGTATAATTTCTAACACCATAAAACTTTCTTTTGATCCTATTTCTTATCTCATTGAACAAATCAGATCAATCAGGTGTTACCCATTAAGA.........GATGGTAGTCACACA---TATTGTGCTAAG...AAAAGAACA---GTATCAGATGATGTTTTAGTAGCAGTTGTGATGGCTTATTTTTTTGCTACCTCAAACAAA------CACATTTTCAAACCACTT
TRN  10010101100011000
NAM  Q66632_9GAMA/1-348
ASQ  MLQKDAKIIFISSVNSSDQTTSFLYNLKNAKEKMLNVVNYVCPQHREDFSLQESVVSCPCYRLHIPTYIAIDENIKDTTNLFMEGAFTTELMGDGAA...ATTQTNMHKVVGEPALVQFDLCRVDTGSPEAQRGLNPTLFLYVDPAYTNNTEASGTGMGAVVSMKNS-DRCVVVGVEHFFLKELTGASSLQIASCAAALIRSLATLHP-FVREAHVAIEGNSSQDSAVAIATLLHERSP------------.LPVKFLHHADKATGVQWPMYILGAEKARAFETFIYALNSNTLSCGQAIVSNTIKLSFDPVAYLIEQIRAIKCYPLK...DGTVS-YCAK.HKG-GSDDTLVAVVMAHYFATSDR--HVFKNH
DSQ  ATGCTGCAAAAGGATGCCAAGATCATTTTCATCTCATCGGTCAACTCCTCCGACCAGACCACCAGCTTCCTGTACAACCTCAAGAACGCCAAGGAAAAAATGCTCAACGTGGTCAACTACGTGTGCCCCCAGCACAGGGAGGACTTTAGCCTGCAGGAGTCGGTGGTCTCGTGCCCCTGCTACCGCCTACACATCCCCACCTACATCGCGATCGATGAGAACATCAAGGACACCACCAACCTGTTTATGGAGGGGGCCTTCACCACCGAGCTCATGGGCGACGGGGCCGCC.........GCGACCACCCAGACCAACATGCACAAGGTGGTGGGCGAGCCCGCGCTCGTCCAGTTTGACCTGTGCCGCGTGGACACGGGCTCCCCCGAGGCCCAGCGCGGCCTGAACCCCACCCTGTTCCTGTACGTGGACCCCGCCTACACCAACAACACGGAGGCCTCGGGCACGGGCATGGGGGCGGTGGTCTCTATGAAAAACAGC---GATAGGTGCGTGGTGGTGGGGGTGGAGCACTTTTTCCTGAAGGAGCTCACGGGGGCCTCCTCGCTGCAGATCGCCAGCTGCGCGGCGGCCCTCATCCGCTCGCTCGCGACGCTGCACCCC---TTCGTGAGGGAGGCGCACGTGGCCATAGAGGGCAACAGCAGCCAGGACTCTGCGGTGGCCATCGCCACCCTGCTGCACGAGCGCAGCCCC------------------------------------...CTGCCGGTCAAGTTCCTGCACCACGCCGACAAGGCCACGGGGGTGCAGTGGCCCATGTACATCCTGGGGGCCGAGAAGGCGCGCGCCTTCGAGACCTTCATCTACGCGCTCAACTCCAACACCCTGAGCTGCGGCCAGGCCATCGTCTCCAACACCATCAAGCTGTCATTCGACCCGGTGGCCTACCTGATAGAGCAGATACGGGCCATCAAGTGCTACCCGCTCAAG.........GACGGCACCGTGTCC---TACTGCGCCAAG...CACAAGGGC---GGCTCGGACGACACCCTGGTGGCGGTGGTCATGGCGCACTACTTTGCCACCTCAGACAGG------CACGTGTTCAAGAACCAC
TRN  10010101100011001
NAM  O40928_HHV8/337-684
ASQ  MLQKDAKLIFISSVNSSDRSTSFLLNLRNAQEKMLNVVSYVCADHREDFHLQDALVSCPCYRLHIPTYITIDESIKTTTNLFMEGAFDTELMGEGAA...SSNAT-LYRVVGDAALTQFDMCRVDTTAQQVQKCLGKQLFVYIDPAYTNNTEASGTGVGAVVTSTQTPTRSLILGMEHFFLRDLTGAAAYEIASCACTMIKAIAVLHP-TIERVNAAVEGNSSQDSGVAIATVLNEICP------------.LPIHFLHYTDKSSALQWPIYMLGGEKSSAFETFIYALNSGTLSASQTVVSNTIKISFDPVTYLVEQVRAIKCVPLR...DGGQS-YSAK.QKH-MSDDLLVAVVMAHFMATDDR--HMYKPI
DSQ  ATGCTTCAGAAAGACGCCAAGCTTATATTTATATCATCCGTGAACTCGTCAGACCGCTCCACGAGTTTCCTGCTTAACCTCAGGAACGCCCAGGAAAAGATGCTGAATGTGGTCAGTTACGTGTGTGCGGACCACCGCGAAGATTTCCACCTGCAAGACGCACTAGTGTCCTGTCCTTGTTACAGACTGCACATTCCGACGTACATCACCATCGACGAATCCATCAAAACCACCACCAACCTCTTTATGGAGGGGGCATTCGACACCGAACTAATGGGCGAGGGAGCAGCG.........TCGTCAAATGCTACG---CTTTACCGCGTGGTGGGTGACGCAGCGCTGACACAGTTTGACATGTGTCGGGTAGACACCACCGCCCAGCAGGTTCAGAAGTGCCTTGGAAAACAGCTGTTTGTTTACATCGACCCCGCGTATACGAACAACACGGAGGCGTCCGGTACTGGCGTGGGCGCCGTTGTCACGAGTACTCAGACTCCCACCAGAAGCCTCATATTGGGCATGGAGCATTTCTTCCTGCGCGACCTCACTGGCGCAGCTGCTTACGAGATAGCGTCCTGCGCATGCACGATGATTAAGGCGATCGCTGTGCTCCACCCC---ACAATTGAGCGCGTGAACGCGGCGGTCGAAGGCAACAGCAGCCAAGATTCTGGGGTGGCCATTGCAACCGTCCTTAACGAAATATGCCCG------------------------------------...CTCCCCATACATTTTCTACACTATACTGACAAGAGCAGCGCCCTGCAGTGGCCAATTTACATGTTGGGAGGCGAGAAATCCTCCGCGTTTGAGACATTCATCTACGCTCTGAACTCCGGCACCCTGAGCGCCAGCCAGACGGTGGTGTCCAACACCATCAAAATATCATTTGACCCGGTGACCTACCTGGTAGAACAGGTCCGCGCGATCAAGTGCGTCCCGCTTAGG.........GATGGAGGGCAGTCA---TACAGCGCCAAG...CAAAAGCAC---ATGTCGGACGACTTACTTGTGGCAGTTGTCATGGCCCATTTTATGGCTACCGATGATAGA------CACATGTACAAGCCCATA
TRN  10010101100011000
NAM  VTER_EBV/342-689
ASQ  MLQKDAKIIFISSVNSADQATSFLYKLKDAQERLLNVVSYVCQEHRQDFDMQDSMVSCPCFRLHIPSYITMDSNIRATTNLFLDGAFSTELMGDTSS...LSQGS-LSRTVRDDAINQLELCRVDTLNPRVAGRLASSLYVYVDPAYTNNTSASGTGIAAVTHDRADPNRVIVLGLEHFFLKDLTGDAALQIATCVVALVSSIVTLHP-HLEEVKVAVEGNSSQDSAVAIASIIGESCP------------.LPCAFVHTKDKTSSLQWPMYLLTNEKSKAFERLIYAVNTASLSASQVTVSNTIQLSFDPVLYLISQIRAIKPIPLR...DGTYT-YTGK.QRN-LSDDVLVALVMAHFLATTQK--HTFKKV
DSQ  ATGCTTCAGAAGGATGCCAAGATTATCTTCATCTCGTCTGTGAACTCGGCTGACCAGGCCACCAGCTTTCTTTATAAGCTGAAGGATGCTCAGGAGCGGCTGCTGAACGTGGTAAGTTATGTGTGTCAGGAGCATCGGCAAGATTTTGACATGCAGGACAGCATGGTCTCATGCCCCTGCTTTCGCCTGCACATCCCGTCCTACATCACCATGGACAGCAACATCCGAGCAACCACCAACCTCTTTCTGGACGGGGCCTTTAGCACCGAGCTGATGGGTGACACCTCCTCG.........CTGAGCCAGGGTAGC---CTGAGCCGCACTGTGCGTGACGATGCCATCAACCAGCTGGAGCTCTGCCGGGTTGACACCCTCAACCCCCGAGTAGCCGGACGCCTAGCCTCCTCCCTCTACGTGTACGTTGATCCGGCCTATACCAACAACACATCCGCATCAGGCACCGGAATCGCCGCCGTGACTCACGACAGGGCGGACCCTAACAGGGTCATCGTCCTGGGCCTGGAACACTTCTTCCTCAAGGACCTAACAGGGGACGCTGCCCTCCAGATCGCCACCTGCGTCGTGGCCCTCGTCTCCTCGATCGTCACCCTGCACCCC---CACTTGGAGGAGGTGAAGGTAGCCGTGGAGGGCAACAGCAGTCAGGACTCTGCGGTGGCCATTGCCTCAATCATTGGGGAATCCTGCCCC------------------------------------...CTCCCCTGCGCCTTCGTGCACACCAAGGACAAGACGTCCAGCCTGCAGTGGCCCATGTACCTCCTGACTAATGAGAAGTCCAAGGCCTTTGAGAGGCTCATCTACGCAGTGAACACGGCCAGCCTTTCTGCCAGTCAGGTCACCGTCTCCAACACCATCCAGCTCTCCTTCGATCCGGTCCTCTATCTCATCTCCCAGATCAGGGCCATCAAGCCCATCCCTCTCCGC.........GACGGTACCTACACC---TACACCGGCAAG...CAGCGCAAC---CTCTCTGACGACGTGCTGGTTGCGCTAGTCATGGCTCATTTTCTCGCAACAACACAGAAG------CACACGTTCAAGAAAGTT
TRN  10010101100011001
NAM  O36378_9GAMA/336-680
ASQ  MLQKDAKIIFISSSNSSDQSTSFLYNLKGASERMLNVVSYVCSNHKEDFSMQDGLISCPCYSLHVPSYISIDEQIKTTTNLFLDGVFDTELMGDSSC...GTLST--FQIISESALSQFELCRIDTASPQVQAHLNSTVHMYIDPAFTNNLDASGTGISVIGRLGAK--TKVILGCEHFFLQKLTGTAALQIASCATSLLRSVVIIHP-MIKCAQITIEGNSSQDSAVAIANFIDECAP------------.IPVTFYHQSDKTKGVLCPLYLLGQEKAVAFESFIYAMNLGLCKASQLIVSHTIKLSFDPVTYLLEQVRAIKCQSLR...DGSHT-YHAK.QKN-LSDDLLVSVVMSLYLSSANT--LPFKPL
DSQ  ATGTTGCAGAAAGACGCTAAGATTATCTTTATATCTTCATCTAACTCATCTGATCAATCCACCAGCTTTTTATACAACCTTAAGGGTGCCAGCGAGAGAATGCTCAATGTTGTCAGCTATGTGTGCTCTAACCACAAAGAAGACTTTAGTATGCAAGATGGCCTTATTTCCTGCCCCTGTTATAGCCTTCACGTCCCCTCTTACATCTCCATTGATGAGCAGATTAAAACCACCACCAACTTATTTCTGGACGGGGTTTTTGACACAGAGCTGATGGGTGATTCTAGCTGT.........GGAACGCTGTCCACC------TTTCAGATAATCAGCGAGTCCGCCCTTTCTCAGTTTGAGTTGTGTAGGATAGACACAGCCTCCCCACAAGTACAAGCCCACCTAAACAGCACTGTTCACATGTACATAGATCCAGCATTTACTAATAATTTAGACGCCTCTGGAACTGGGATATCTGTAATTGGGCGGTTAGGAGCCAAA------ACTAAAGTTATCCTTGGCTGTGAACATTTTTTTCTTCAAAAGCTCACTGGCACAGCTGCCCTACAGATCGCTTCCTGTGCTACTTCCTTACTGCGGTCTGTGGTTATAATCCATCCC---ATGATAAAATGCGCTCAAATAACTATAGAGGGGAACAGCAGCCAAGACTCCGCAGTGGCAATTGCCAACTTTATTGACGAGTGCGCCCCT------------------------------------...ATCCCAGTCACATTTTACCACCAGTCTGACAAAACAAAGGGAGTGTTGTGCCCCCTCTATCTCCTCGGGCAGGAAAAGGCGGTAGCTTTTGAGTCATTCATCTATGCCATGAACCTGGGATTATGTAAGGCAAGTCAGTTAATTGTGTCTCATACAATAAAGCTCTCGTTTGATCCTGTGACCTACTTACTAGAGCAGGTCCGGGCCATCAAATGTCAGTCTCTAAGA.........GACGGCAGCCACACC---TACCATGCGAAG...CAAAAGAAC---TTGTCTGATGACTTACTCGTCTCTGTAGTGATGAGCTTGTATTTGTCCAGTGCCAACACC------CTCCCATTCAAGCCACTG
TRN  10010101100011000
NAM  O41945_MHV68/1-345
ASQ  MLQKDAKIFFISSVNSGEKTTSFLYNLKDANEKMVNVVSYVCSEHMEDFNKQSAITACPCYRLYVPEFITINDNIKCTTNLLLEGSFATELMGNMQS...HTEVS-GNSMIHESSLTRLDFYRCDTAG-QGAPTTENTLFVYIDPAYGNNVHASGTGIVAMSHCKHT-KKCIILGLEHFFLNNLTGTAAHNIASCATALLEGILFQHP-WIQEIRCIIEGNSNQDSAVAIATFISHNIK------------.LPTLFASYRDKT-GMQWPIYMLSGDKTLAFQNFISSLNQGLLCASQTVVSNTVLLSSDPISYLIEQIKNTKCIYHK...NKTIT-FQSK.THT-MSDDVLIACVMTCYVMTTNK--ISYISF
DSQ  ATGTTACAGAAGGATGCCAAGATCTTTTTTATCTCCTCTGTAAATTCAGGAGAGAAGACAACAAGTTTTTTGTATAACCTCAAAGATGCCAATGAGAAGATGGTGAACGTTGTCAGCTATGTCTGTAGCGAACATATGGAAGACTTCAACAAACAGAGCGCAATCACTGCCTGCCCTTGCTATCGCCTGTATGTTCCAGAATTTATCACCATCAATGATAATATAAAGTGTACCACCAATTTACTGCTAGAGGGATCATTTGCCACAGAATTAATGGGCAATATGCAATCA.........CACACGGAAGTCTCT---GGGAACAGTATGATACACGAGTCCAGTCTGACCCGGCTAGACTTTTATAGGTGTGACACTGCGGGC---CAGGGGGCCCCAACTACAGAAAATACACTTTTTGTGTATATTGACCCCGCCTATGGAAACAACGTCCACGCCTCTGGAACTGGTATAGTTGCCATGAGTCACTGTAAACACACT---AAAAAGTGTATTATCTTAGGGTTGGAACATTTCTTCCTGAACAACCTCACTGGAACTGCTGCTCACAACATAGCCTCATGTGCCACTGCTCTGTTGGAGGGAATATTGTTTCAACACCCC---TGGATTCAAGAAATCAGGTGTATAATAGAGGGAAATAGCAATCAAGACTCAGCTGTAGCCATAGCAACTTTTATTTCCCACAACATTAAA------------------------------------...CTACCAACCCTGTTTGCCTCCTACAGAGACAAGACT---GGAATGCAATGGCCTATTTATATGTTGAGTGGAGACAAGACACTGGCCTTCCAAAACTTTATCTCTTCATTGAACCAGGGATTGCTCTGTGCCAGCCAAACCGTGGTATCTAACACTGTCCTGCTGTCTAGTGACCCAATCTCCTATCTGATTGAACAGATAAAAAATACCAAATGTATATACCACAAG.........AACAAAACCATAACC---TTCCAATCCAAA...ACACATACA---ATGTCTGATGATGTTCTAATTGCGTGTGTTATGACCTGTTACGTGATGACAACAAACAAG------ATATCATACATCTCTTTT
TRN  10010101100011000
//