EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02494 - HYR)
FAM  PF02494
PID  HYR
DES  HYR domain
IPR  IPR003410
ANO  19
ALN  87
AID  0.422513
APH  (((SRPX_HUMAN/175-257:0.25430,O60687_HUMAN/177-259:0.38514):0.68397,((P90891_CAEEL/2293-2373:1.11366,P91526_CAEEL/629-701:0.80110):0.14614,Q20535_CAEEL/1111-1195:0.90583):0.14580):0.33143,(HYAL_STRPU/882-964:0.45993,(HYAL_STRPU/798-879:0.25600,((((HYAL_LYTVA/404-484:0.17770,HYAL_STRPU/1051-1131:0.12409):0.07709,(HYAL_STRPU/546-627:0.21035,(HYAL_STRPU/461-542:0.29675,(((HYAL_LYTVA/320-401:0.17457,HYAL_STRPU/40-121:0.07305):0.06733,HYAL_LYTVA/151-232:0.15107):0.04119,HYAL_LYTVA/67-148:0.20179):0.13521):0.04388):0.22986):0.02338,HYAL_STRPU/967-1048:0.19596):0.04972,(HYAL_STRPU/714-795:0.19491,HYAL_STRPU/630-711:0.07202):0.08845):0.03512):0.36898):0.10886,Q20535_CAEEL/1196-1277:1.59732);
ATP  (((SRPX_HUMAN/175-257,O60687_HUMAN/177-259),((P90891_CAEEL/2293-2373,P91526_CAEEL/629-701),Q20535_CAEEL/1111-1195)),(HYAL_STRPU/882-964,(HYAL_STRPU/798-879,((((HYAL_LYTVA/404-484,HYAL_STRPU/1051-1131),(HYAL_STRPU/546-627,(HYAL_STRPU/461-542,(((HYAL_LYTVA/320-401,HYAL_STRPU/40-121),HYAL_LYTVA/151-232),HYAL_LYTVA/67-148)))),HYAL_STRPU/967-1048),(HYAL_STRPU/714-795,HYAL_STRPU/630-711)))),Q20535_CAEEL/1196-1277);
ATL  10.222
DNO  15
DLN  261
DID  0.452364
DPH  ((((((((((HYAL_STRPU/714-795:0.28253,HYAL_STRPU/630-711:0.13199):0.04486,(HYAL_STRPU/967-1048:0.16305,HYAL_STRPU/1051-1131:0.25074):0.06548):0.06683,((HYAL_STRPU/40-121:0.28455,HYAL_STRPU/461-542:0.29276):0.05849,HYAL_STRPU/546-627:0.26149):0.11208):0.14586,HYAL_STRPU/798-879:0.19572):0.18532,P90891_CAEEL/2293-2373:0.85514):0.10597,HYAL_STRPU/882-964:0.30364):0.20727,Q20535_CAEEL/1196-1277:0.74179):0.07458,Q20535_CAEEL/1111-1195:0.75072):0.07369,P91526_CAEEL/629-701:0.70957):0.35559,O60687_HUMAN/177-259:0.32316,SRPX_HUMAN/175-257:0.26542);
DTP  ((((((((((HYAL_STRPU/714-795,HYAL_STRPU/630-711),(HYAL_STRPU/967-1048,HYAL_STRPU/1051-1131)),((HYAL_STRPU/40-121,HYAL_STRPU/461-542),HYAL_STRPU/546-627)),HYAL_STRPU/798-879),P90891_CAEEL/2293-2373),HYAL_STRPU/882-964),Q20535_CAEEL/1196-1277),Q20535_CAEEL/1111-1195),P91526_CAEEL/629-701),O60687_HUMAN/177-259,SRPX_HUMAN/175-257);
DTL  7.28544
RID  0.384252
RPH  (((((((HYAL_STRPU/1051-1131:0.17207,(HYAL_STRPU/967-1048:0.17745,((HYAL_STRPU/630-711:0.07966,HYAL_STRPU/714-795:0.18788):0.06611,HYAL_STRPU/798-879:0.27901):0.07395):0.03800):0.05586,((HYAL_STRPU/40-121:0.29672,HYAL_STRPU/461-542:0.32641):0.02452,HYAL_STRPU/546-627:0.21184):0.15918):0.33843,(HYAL_STRPU/882-964:0.34171,Q20535_CAEEL/1196-1277:1.76625):0.11209):0.33053,P90891_CAEEL/2293-2373:1.13670):0.16543,Q20535_CAEEL/1111-1195:0.93204):0.00000,P91526_CAEEL/629-701:0.94755):0.78989,O60687_HUMAN/177-259:0.42340,SRPX_HUMAN/175-257:0.21439);
RTP  (((((((HYAL_STRPU/1051-1131,(HYAL_STRPU/967-1048,((HYAL_STRPU/630-711,HYAL_STRPU/714-795),HYAL_STRPU/798-879))),((HYAL_STRPU/40-121,HYAL_STRPU/461-542),HYAL_STRPU/546-627)),(HYAL_STRPU/882-964,Q20535_CAEEL/1196-1277)),P90891_CAEEL/2293-2373),Q20535_CAEEL/1111-1195),P91526_CAEEL/629-701),O60687_HUMAN/177-259,SRPX_HUMAN/175-257);
RTL  9.51996
LNK  HYAL_LYTVA/151-232:O96530:
LNK  HYAL_LYTVA/320-401:O96530:
LNK  HYAL_LYTVA/404-484:O96530:
LNK  HYAL_LYTVA/67-148:O96530:
LNK  HYAL_STRPU/1051-1131:O76536:AF076472
LNK  HYAL_STRPU/40-121:O76536:AF076472
LNK  HYAL_STRPU/461-542:O76536:AF076472
LNK  HYAL_STRPU/546-627:O76536:AF076472
LNK  HYAL_STRPU/630-711:O76536:AF076472
LNK  HYAL_STRPU/714-795:O76536:AF076472
LNK  HYAL_STRPU/798-879:O76536:AF076472
LNK  HYAL_STRPU/882-964:O76536:AF076472
LNK  HYAL_STRPU/967-1048:O76536:AF076472
LNK  O60687_HUMAN/177-259:O60687:AF060567
LNK  P90891_CAEEL/2293-2373:P90891:Z81091
LNK  P91526_CAEEL/629-701:P91526:U80815
LNK  Q20535_CAEEL/1111-1195:Q20535:U61946
LNK  Q20535_CAEEL/1196-1277:Q20535:U61946
LNK  SRPX_HUMAN/175-257:P78539:U78093
AMK  xxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q20535_CAEEL/1196-1277
ASQ  PDTQPPVM-KCPDS.--YTIPVGNSTKHVIFDMTTVDMVLHDTSNVSDVTFTPSEATLKIGEFEEVTAQAEDENGNRN-SCKFQVAY
DSQ  CCAGATACCCAGCCACCTGTCATG---AAATGTCCGGACTCG...------TACACCATCCCTGTTGGAAACTCCACGAAGCACGTGATCTTCGACATGACCACTGTAGATATGGTACTTCATGACACCTCCAACGTGTCCGACGTGACCTTCACACCATCTGAGGCTACACTGAAGATCGGAGAGTTTGAGGAGGTGACGGCGCAGGCGGAGGATGAGAATGGAAATCGGAAC---AGCTGCAAGTTCCAGGTCGCGTAT
TRN  11011101101011011
NAM  Q20535_CAEEL/1111-1195
ASQ  VDMEPPKFENCPESeIFAKVDENGQLKAVEFEEPAASDNSGKIAYTQIEPLGMRTGLMITE-DMDVTYTAFDSAGNTA-VCVLKIRI
DSQ  GTTGATATGGAGCCTCCGAAGTTTGAGAACTGCCCAGAGTCGgagATCTTTGCCAAGGTTGATGAAAATGGACAGTTGAAGGCTGTCGAGTTTGAGGAACCAGCTGCAAGTGATAATAGTGGAAAGATCGCCTACACCCAGATTGAGCCCCTCGGAATGCGAACTGGCCTAATGATCACAGAG---GATATGGATGTCACCTACACCGCATTCGACTCTGCTGGAAACACTGCA---GTTTGTGTTCTGAAAATCCGCATT
TRN  11011101101011011
NAM  P90891_CAEEL/2293-2373
ASQ  KDRLPPTVLRCPKN.IRKGTTEDFTKVEWPDEDVAFFDNIG---VIRIEVNYHNGQQFGVG-ITTVRYVGFDAAGNSA-ECTFDVTI
DSQ  AAGGATCGTCTTCCACCAACAGTTCTCCGATGCCCAAAAAAC...ATTCGCAAAGGTACAACAGAAGACTTTACAAAAGTTGAATGGCCCGATGAGGATGTTGCATTTTTTGATAACATTGGA---------GTTATCAGAATTGAAGTCAATTATCATAATGGACAGCAGTTTGGAGTTGGA---ATCACCACAGTTCGTTATGTTGGTTTTGATGCTGCTGGAAATTCTGCA---GAGTGTACATTTGATGTCACGATA
TRN  10010101110011011
NAM  HYAL_STRPU/882-964
ASQ  VDTMMPMFTSCPNN.IVQSVELGVPGTVISWTTPTANDAAG---IASIVSNLQPGSFFTVGESATVTYVATDNSGLTDNSCSFTVTV
DSQ  GTTGACACCATGATGCCCATGTTTACTAGCTGCCCAAACAAC...ATTGTTCAGTCAGTCGAGCTCGGAGTCCCAGGAACTGTCATCAGCTGGACCACTCCCACGGCCAACGATGCCGCAGGT---------ATCGCTTCAATCGTATCCAACCTCCAACCCGGATCGTTCTTCACTGTCGGAGAGTCGGCGACCGTCACGTACGTTGCGACTGATAACAGCGGCCTGACCGACAACTCCTGTTCATTTACAGTCACCGTC
TRN  11011111101111101
NAM  HYAL_STRPU/798-879
ASQ  VDTTPPTV-NCANN.IAQTIELGSTSAVVNYAEPSATDISG--TAFLVSRSSSPGDSFPIG-STTVTYIFSDQSGNEAPPCVFTVTI
DSQ  GTTGACACCACCCCACCAACGGTT---AATTGCGCCAACAAC...ATTGCTCAGACCATTGAACTTGGATCGACCAGTGCCGTCGTGAACTATGCCGAGCCATCCGCTACAGACATCTCTGGA------ACAGCTTTCCTAGTGTCCAGGAGTAGCTCACCAGGAGATTCATTCCCCATCGGC---TCGACCACCGTCACCTACATCTTCAGTGACCAGAGCGGCAATGAAGCACCACCTTGTGTCTTCACAGTCACCATT
TRN  10010101110011001
NAM  HYAL_LYTVA/404-484
ASQ  EDTTPPTV-NCIND.VIRTVELGTTSAQVFYSEPTASDV-G--QATLISRTAQPGDSFPVG-ATVVTYIFGDNAGNIADPCVFTITV
NAM  HYAL_STRPU/1051-1131
ASQ  QDTTPPTV-NCITN.IVRTVELGTSSVQVFYNEPTASDL-G--QASLVSRTAQPGDNFPVG-VNPVTYVFGDNSGNQADPCTFTITV
DSQ  CAGGACACAACGCCTCCTACCGTG---AACTGCATCACCAAT...ATCGTACGAACCGTGGAGTTGGGTACCAGCAGTGTTCAGGTCTTCTATAATGAACCAACGGCATCTGATCTT---GGC------CAGGCAAGTCTTGTCAGTAGGACCGCCCAGCCGGGAGATAACTTCCCCGTCGGT---GTGAACCCAGTGACCTACGTCTTTGGGGACAACTCTGGCAACCAGGCTGACCCCTGCACCTTCACCATCACTGTG
TRN  10010101110011011
NAM  HYAL_STRPU/967-1048
ASQ  VDTTPPSV-VCTNN.VFQTVELGTNPVQVFYTEPTASDISG--QANLVSRTNVPGDSFPVG-TSTVTYVFADNSGNTADACSFTITV
DSQ  GTTGACACTACACCACCCTCCGTG---GTCTGTACCAACAAT...GTTTTCCAGACTGTCGAACTTGGCACAAACCCTGTTCAGGTTTTCTACACCGAGCCAACAGCCTCTGATATTTCCGGC------CAGGCCAACCTCGTAAGCAGGACAAACGTTCCAGGAGATTCCTTCCCGGTAGGA---ACCTCAACGGTGACCTACGTCTTTGCTGACAACTCTGGCAACACTGCAGATGCCTGTTCTTTCACTATCACTGTC
TRN  10010101110011001
NAM  HYAL_STRPU/714-795
ASQ  VDTTPPTV-NCINN.VAQTVQLGTGSTQVFFTEPTAFDISG--QTSLVTRTSAPGDSFPVG-TTSVTYIFTDASGNNAQPCTFNVVI
DSQ  GTCGATACCACACCACCCACTGTC---AACTGTATCAACAAT...GTCGCTCAGACGGTCCAGCTCGGCACCGGCAGCACCCAGGTTTTCTTTACAGAACCTACCGCCTTTGATATCTCAGGA------CAGACCAGCCTGGTGACTCGCACATCAGCTCCAGGGGACAGCTTCCCAGTGGGT---ACCACAAGTGTCACCTACATTTTCACCGATGCCTCAGGCAACAACGCCCAGCCTTGTACCTTCAATGTGGTTATC
TRN  11011111101111101
NAM  HYAL_STRPU/630-711
ASQ  VDTTPPSV-NCPNN.VFQEVELGTSSAPVFFTEPTAFDISG--QANLVTRTAAPGDSFPVG-TTSVSYIFSDNSGNEAEPCTFTVTI
DSQ  GTTGACACCACCCCACCTTCCGTC---AACTGTCCTAACAAC...GTATTCCAAGAAGTGGAACTCGGTACCTCCAGTGCCCCGGTCTTCTTCACCGAACCAACTGCCTTTGACATTTCCGGA------CAAGCCAACCTTGTGACCCGAACAGCAGCCCCAGGAGATTCCTTCCCTGTAGGG---ACTACCTCCGTGTCTTACATCTTCAGTGATAACTCTGGAAACGAGGCTGAACCCTGTACTTTCACAGTAACCATC
TRN  11011111111111111
NAM  HYAL_STRPU/546-627
ASQ  VDTTPPTV-TVSGGnIVRTVELGQSRLSVIYTEPTATDNSG--EANLVSRTAQPGDLFPVG-TTTVEYVYQDPAGNEG-RGQFTVTV
DSQ  GTTGATACCACCCCACCTACAGTC---ACTGTCAGTGGAGGAaacATCGTACGAACCGTGGAGCTTGGCCAGAGCCGTCTCTCGGTGATCTACACCGAGCCAACCGCTACTGATAACTCTGGG------GAAGCCAACCTGGTGAGCCGCACAGCTCAGCCTGGCGATCTCTTCCCCGTCGGC---ACCACAACCGTGGAGTACGTCTATCAGGATCCTGCTGGTAACGAGGGT---AGAGGTCAATTCACGGTGACCGTC
TRN  10010101100011011
NAM  HYAL_STRPU/461-542
ASQ  VDTTPPQV-FVTTGeVVRTAPFGSSGVNVFFTEPVAIDNSG--TADLVSQTAQPGDFFPIG-STVVTYRYRDASGNEA-TGTFTVTV
DSQ  GTGGACACTACACCACCTCAAGTC---TTTGTGACCACCGGCgaaGTTGTTCGCACAGCACCTTTCGGATCCTCAGGTGTAAATGTCTTCTTCACCGAACCAGTTGCTATTGATAACTCCGGC------ACCGCAGACCTTGTGAGCCAAACGGCTCAGCCGGGCGATTTCTTTCCAATTGGA---AGCACTGTGGTAACCTATCGATATCGAGATGCATCGGGCAATGAAGCT---ACTGGCACTTTCACTGTCACCGTT
TRN  11011111111111101
NAM  HYAL_LYTVA/67-148
ASQ  TDSIDPVV-TVSSGfITQQVEIGLGGVNVFYTEPTATDNSG--TAVLFSRSAQPGDFFPVG-QTVVTYIFQDPSGNFG-TGTFTVNV
NAM  HYAL_LYTVA/151-232
ASQ  VDTTPPVV-TVPNGiITRQVEIGTSGIIVFFSEPTATDNSG--TAILDSRTHQPGDVFPVG-QTIVTYTFRDPAGNPA-TGTFTINV
NAM  HYAL_LYTVA/320-401
ASQ  VDTTPPVI-SVPSTfITRTVELGTPGVNVFYPEPTASDNSG--TAILVTRTNQPGDFFSVG-QTVVTYTFQDPTGNPA-TATVTINI
NAM  HYAL_STRPU/40-121
ASQ  TDTTPPVV-TVSSStITRQVEVGTPGVNVFFTEPTATDNSG--QAILISRTNQPGDFFSVG-QTIVTYTFQDPSGNPA-SGTVTINV
DSQ  ACTGACACTACACCACCTGTCGTA---ACGGTGTCCAGTAGTacaATCACCCGTCAAGTTGAAGTTGGAACCCCCGGTGTCAATGTATTTTTCACTGAGCCTACTGCTACTGATAACTCTGGG------CAAGCTATCCTTATCAGCCGTACCAACCAACCTGGAGACTTTTTCTCAGTCGGT---CAGACCATTGTGACCTACACTTTCCAAGATCCTTCTGGAAACCCAGCC---TCTGGCACTGTTACTATCAATGTT
TRN  11011111111111101
NAM  SRPX_HUMAN/175-257
ASQ  VDMEPPRI-KCPSV.KERIAEPNKLTVRVSWETPEGRDTADGILTDVILKGLPPGSNFPEG-DHKIQYTVYDRAENKG-TCKFRVKV
DSQ  GTGGATATGGAACCTCCTAGAATC---AAGTGCCCAAGTGTG...AAGGAACGCATTGCAGAACCCAACAAACTGACAGTCCGGGTGTCCTGGGAGACACCCGAAGGAAGAGACACAGCAGATGGAATTCTTACTGATGTCATTCTAAAAGGCCTCCCCCCAGGCTCCAACTTTCCAGAAGGA---GACCACAAGATCCAGTACACAGTCTATGACAGAGCTGAGAATAAGGGC---ACTTGCAAATTTCGAGTTAAAGTA
TRN  10010101100011011
NAM  O60687_HUMAN/177-259
ASQ  VDIDPPKI-RCPHS.REKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEG-EHVIRYTAYDRAYNRA-SCKFIVKV
DSQ  GTAGACATAGATCCCCCCAAGATC---CGCTGTCCCCACTCA...CGTGAGAAGATGGCAGAGCCAGAGAAATTGACTGCTCGAGTATACTGGGACCCACCGTTGGTGAAAGATTCTGCTGATGGTACCATCACCAGGGTGACACTTCGGGGCCCTGAGCCTGGCTCTCACTTTCCCGAAGGA---GAGCATGTGATTCGTTACACTGCCTATGACCGAGCCTACAACCGGGCC---AGCTGCAAGTTCATTGTGAAAGTA
TRN  10010101110011001
NAM  P91526_CAEEL/629-701
ASQ  IEDCPSDM------.---VISSMDRETNVTWPEPTFLSSNS--KIEKIEKNLKQGQMFTWG-EYDVLYTATDNATNQA-QCNFKIRV
DSQ  ATCGAAGACTGCCCATCTGACATG------------------...---------GTGATCTCCTCTATGGACCGAGAGACAAATGTAACCTGGCCGGAACCTACCTTCCTGAGCTCTAACTCC------AAAATCGAGAAAATCGAGAAAAATCTGAAGCAAGGACAGATGTTCACATGGGGA---GAGTATGATGTGCTGTATACCGCCACGGATAATGCTACCAATCAAGCT---CAATGCAACTTCAAGATCCGAGTT
TRN  11011101101011011
//