EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02447 - GntP_permease)
FAM  PF02447
PID  GntP_permease
DES  GntP family permease
IPR  IPR003474
ANO  12
ALN  467
AID  0.381984
APH  ((YOJA_BACSU/1-443:0.30565,GNTP_BACLI/1-447:0.22302):0.08788,((IDNT_ECOLI/1-437:0.33132,GNTT_ECOLI/1-437:0.22098):0.12890,((((GNUT_PSEAE/9-449:0.31361,GNTP_ZYMMO/7-450:0.57653):0.14209,DSDX_ECOLI/6-444:0.74829):0.12049,(GNTU_ECOLI/4-445:0.70086,(YGBN_ECOLI/4-454:0.82630,Y1015_HAEIN/6-457:0.85599):0.16848):0.17265):0.14155,GNTP_ECOLI/4-446:0.71377):0.09728):0.17162,YJHF_ECOLI/1-448:0.38232);
ATP  ((YOJA_BACSU/1-443,GNTP_BACLI/1-447),((IDNT_ECOLI/1-437,GNTT_ECOLI/1-437),((((GNUT_PSEAE/9-449,GNTP_ZYMMO/7-450),DSDX_ECOLI/6-444),(GNTU_ECOLI/4-445,(YGBN_ECOLI/4-454,Y1015_HAEIN/6-457))),GNTP_ECOLI/4-446)),YJHF_ECOLI/1-448);
ATL  7.42958
DNO  12
DLN  1401
DID  0.486511
DPH  ((YOJA_BACSU/1-443:0.30713,GNTP_BACLI/1-447:0.22611):0.10361,((IDNT_ECOLI/1-437:0.31058,GNTT_ECOLI/1-437:0.20816):0.09862,((((GNUT_PSEAE/9-449:0.26468,GNTP_ZYMMO/7-450:0.41782):0.09328,DSDX_ECOLI/6-444:0.51282):0.04585,(GNTU_ECOLI/4-445:0.46249,(YGBN_ECOLI/4-454:0.51124,Y1015_HAEIN/6-457:0.61655):0.13667):0.09299):0.07633,GNTP_ECOLI/4-446:0.50550):0.06722):0.11423,YJHF_ECOLI/1-448:0.33680);
DTP  ((YOJA_BACSU/1-443,GNTP_BACLI/1-447),((IDNT_ECOLI/1-437,GNTT_ECOLI/1-437),((((GNUT_PSEAE/9-449,GNTP_ZYMMO/7-450),DSDX_ECOLI/6-444),(GNTU_ECOLI/4-445,(YGBN_ECOLI/4-454,Y1015_HAEIN/6-457))),GNTP_ECOLI/4-446)),YJHF_ECOLI/1-448);
DTL  5.50868
RID  0.381984
RPH  ((YOJA_BACSU/1-443:0.30565,GNTP_BACLI/1-447:0.22302):0.08788,((IDNT_ECOLI/1-437:0.33132,GNTT_ECOLI/1-437:0.22098):0.12890,((((GNUT_PSEAE/9-449:0.31361,GNTP_ZYMMO/7-450:0.57653):0.14209,DSDX_ECOLI/6-444:0.74829):0.12049,(GNTU_ECOLI/4-445:0.70086,(YGBN_ECOLI/4-454:0.82630,Y1015_HAEIN/6-457:0.85599):0.16848):0.17265):0.14155,GNTP_ECOLI/4-446:0.71377):0.09728):0.17162,YJHF_ECOLI/1-448:0.38232);
RTP  ((YOJA_BACSU/1-443,GNTP_BACLI/1-447),((IDNT_ECOLI/1-437,GNTT_ECOLI/1-437),((((GNUT_PSEAE/9-449,GNTP_ZYMMO/7-450),DSDX_ECOLI/6-444),(GNTU_ECOLI/4-445,(YGBN_ECOLI/4-454,Y1015_HAEIN/6-457))),GNTP_ECOLI/4-446)),YJHF_ECOLI/1-448);
RTL  7.42958
LNK  DSDX_ECOLI/6-444:P08555:X91821
LNK  GNTP_BACLI/1-447:P46832:D31631
LNK  GNTP_ECOLI/4-446:P39373:U14003
LNK  GNTP_ZYMMO/7-450:Q9Z670:AF102543
LNK  GNTT_ECOLI/1-437:P39835:U00096
LNK  GNTU_ECOLI/4-445:P46858:D84362
LNK  GNUT_PSEAE/9-449:Q9ZIJ1:AF026470
LNK  IDNT_ECOLI/1-437:P39344:U14003
LNK  Y1015_HAEIN/6-457:P71364:U32782
LNK  YGBN_ECOLI/4-454:Q46892:U29579
LNK  YJHF_ECOLI/1-448:P39357:U00096
LNK  YOJA_BACSU/1-443:O31862:AF026147
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YJHF_ECOLI/1-448
ASQ  MPLIIVVAG-IALLLLLTIKIKLNTFVSLIIVSIAVAIASGMDLSKVVTSVESGLGGTLGHIGLIFGFGVMLGRLLADAGGAQRIALTMLNYFGKNKLDWAVVCSAFIVGIALFFEVGLILLVPILFAIAREAKISPMFMCVPMLSGLLVAHGFLPPHPGPTVIAREYGADVGLVLIYGIIVG-IPTFIL---CGPVLNK---FCQRIIPDAFKKEGNIASLGATRRFSESEMPGFGISFLTAMLPVILMAVVTIIQMTHAKSAADSGLF.YNVILFLGNSTIAMLISLLFAIYTMGLGRGKTIPDLMDSCGKAIAGIAGLLLIIGGGGAFKQVLIDSGVGQYISTLVSGMDINPILMAWGVAAFLRICLGSATVAAISTAGLVI-----PLLAVHP--.NTNLALITLATGAGSCICSHVNDASFWMIKDFFGLT-TKETLLSWTLMSTLLSISGLIFIL-LASLV
DSQ  ATGCCACTAATTATCGTTGTGGCAGGG---ATTGCTTTACTCCTGCTTTTAACCATAAAAATTAAGCTTAATACGTTTGTTTCGTTAATTATTGTCTCGATTGCTGTCGCCATCGCCAGTGGTATGGATTTGAGTAAAGTCGTCACCTCAGTCGAATCCGGACTTGGCGGTACGCTGGGCCATATTGGTTTGATATTTGGCTTCGGTGTTATGCTCGGTCGCTTGCTGGCCGATGCGGGTGGTGCGCAGCGAATAGCGCTGACCATGCTGAATTATTTCGGGAAAAATAAACTTGACTGGGCAGTGGTCTGTTCGGCGTTTATTGTCGGTATCGCACTTTTTTTCGAAGTCGGTTTAATTCTTCTGGTACCTATTTTATTCGCTATTGCCCGTGAAGCAAAAATATCACCGATGTTTATGTGTGTGCCGATGCTTTCTGGTTTGCTGGTCGCACACGGTTTTTTGCCGCCGCACCCCGGCCCGACTGTTATCGCCAGGGAATATGGCGCTGATGTAGGATTGGTACTGATATACGGTATCATTGTCGGC---ATTCCAACCTTTATTCTT---------TGCGGCCCGGTATTGAATAAA---------TTCTGCCAGCGCATTATTCCGGACGCCTTTAAAAAAGAGGGGAATATAGCCTCTCTCGGCGCGACCCGCCGATTCAGCGAAAGCGAAATGCCAGGCTTTGGGATCAGTTTTCTCACGGCAATGCTGCCGGTGATCCTGATGGCGGTTGTCACCATCATCCAGATGACTCATGCCAAAAGTGCCGCGGATTCAGGCTTATTT...TACAACGTGATACTGTTCTTAGGTAATTCAACGATCGCCATGCTGATTTCACTGCTATTCGCGATCTATACCATGGGCCTGGGGCGCGGGAAAACAATCCCTGACCTGATGGATTCTTGCGGAAAAGCTATCGCGGGTATTGCCGGTCTGCTGCTGATTATCGGTGGTGGTGGTGCATTCAAGCAAGTTCTCATCGACTCTGGCGTTGGTCAGTATATTTCCACCCTGGTTTCGGGTATGGATATTAACCCGATCCTGATGGCCTGGGGCGTGGCCGCATTCCTGCGTATTTGTCTGGGTTCAGCCACCGTCGCGGCGATCTCTACCGCCGGTCTGGTCATC---------------CCATTGTTGGCAGTACATCCC------...AATACCAACCTGGCCTTGATTACGCTGGCTACCGGTGCCGGATCCTGTATTTGTTCTCACGTTAACGATGCCAGTTTCTGGATGATTAAAGACTTTTTTGGCCTGACC---ACCAAAGAAACGCTGTTATCCTGGACGCTGATGTCCACACTCTTATCCATCAGTGGGCTGATTTTTATTCTG---CTCGCCAGCTTAGTT
TRN  10010101100011000
NAM  YOJA_BACSU/1-443
ASQ  MPILIVAVG-VLILLFLIIKVKLNTFVSLIVVSFLVAIGLGMDINKIVLSIETGIGGQLGHLALVFGLGAMLGRLVSDAGGGYRIAITLIDKFGRKRIQAAVVVASFIIGIALFFEVGLVLLIPIVYAIAKELKMPFLYLGIPMAAALNVTHGFLPPHPAPTAISVAYGAHIGQVLLFGIIIA-VPTTVI---AGPLFNK---FAMKRFPGAYQKHGNLSGLGPRKEFQLDETPGFAISAVTSLFPVIFMAMATIFSLLLSEHSKGKD--.--IIEFIGTPGTAMLISLLLALYTMGYARKISMQEIGRSISESISQIAMMLLIIGGGGAFKQVLIDGGVGDYVADFFRQTNMSPLFVAWTIAAVLRLCLGSATVAALTTAGMAA-----PLMEAG---.SVNPALMVLATGAGSVIACHVNDAGFWMVKEFFGLS-MKETFQTWTLLTTVLSVTGLGCVL-LAGLV
DSQ  ATGCCGATTTTAATTGTAGCTGTCGGA---GTGCTGATTCTGTTATTTCTCATTATTAAAGTAAAATTAAATACCTTTGTCTCACTGATTGTCGTTTCATTTTTAGTAGCCATCGGACTTGGAATGGATATCAATAAAATTGTTCTTTCAATTGAGACTGGAATTGGCGGGCAGCTGGGGCATTTAGCTTTAGTGTTTGGACTTGGCGCGATGCTTGGGAGGCTTGTCTCAGATGCTGGGGGCGGCTACCGGATCGCCATTACGCTGATTGACAAATTCGGGAGGAAACGAATACAGGCGGCGGTTGTGGTTGCCTCTTTTATCATCGGGATTGCCCTATTTTTTGAAGTCGGTCTTGTTCTGTTGATACCGATTGTTTACGCGATTGCTAAAGAATTAAAAATGCCTTTTCTGTATCTGGGAATCCCGATGGCCGCCGCCTTAAATGTTACTCACGGATTTTTGCCCCCGCATCCTGCTCCAACTGCTATCTCAGTTGCATATGGTGCCCATATTGGCCAGGTGCTGCTTTTTGGAATCATCATCGCT---GTTCCGACAACTGTGATT---------GCCGGGCCTTTATTTAATAAA---------TTTGCGATGAAACGGTTTCCTGGTGCGTATCAAAAGCATGGAAACCTATCGGGGTTAGGACCAAGGAAAGAATTTCAGCTGGATGAAACACCGGGCTTTGCGATCAGTGCTGTCACGTCTTTATTCCCGGTTATCTTTATGGCAATGGCAACAATTTTTTCTTTATTATTGAGTGAACATTCAAAAGGAAAAGAC------...------ATTATAGAATTTATCGGCACTCCGGGAACGGCAATGCTCATTTCGCTGTTGCTTGCACTCTATACGATGGGATATGCCCGTAAAATATCTATGCAGGAAATCGGCAGATCTATTTCAGAATCAATTTCGCAAATTGCGATGATGCTGCTCATCATAGGAGGGGGAGGAGCGTTTAAACAGGTGCTGATTGACGGCGGAGTCGGCGATTATGTCGCTGATTTTTTCCGTCAAACAAACATGTCGCCGCTATTCGTTGCATGGACCATCGCCGCGGTTCTGCGTCTGTGTCTAGGCTCTGCTACCGTGGCTGCGCTTACCACAGCGGGAATGGCAGCT---------------CCGCTTATGGAGGCTGGC---------...AGTGTAAACCCTGCGTTAATGGTGCTTGCAACAGGAGCCGGCAGTGTCATTGCGTGTCATGTAAATGATGCAGGATTTTGGATGGTAAAGGAATTTTTCGGCTTGAGC---ATGAAAGAAACATTTCAAACCTGGACGCTGCTTACAACAGTTCTTTCGGTTACAGGGCTCGGCTGTGTGTTA---TTGGCAGGGCTTGTG
TRN  10010101100011000
NAM  GNTP_BACLI/1-447
ASQ  MPLLIVAIG-IVALLLLIMGLKLNTFVSLIIVSFGVALALGMPLDDIVKTIEEGLGGTLGHIALIFGLGAMLGRLIADSGGAQRIAMTLVNKFGEENIQWAVVIASFIIGVALFFEVALVLLIPIVFAISKELEISISYLGIPMTAALSVTHGFLPPHPGPTAIAGELGANIGEVLLYGIIVA-IPTVLL---AGPLFTK---LAKKIVPQSFEKMGSIASLGEQKTFKLEETPGFGISVFTAMLPVIIMSISTVITLIQETMGLADNSL.LAAVRLIGNASTSMVISLLVAIYTMGIARKIPIKQVMDSCSTAITQIGMMLLIIGGGGAFKQVLINGGVGDYVAELFKGTAMSPILLAWVIAAILRISLGSATVAALSTTGLVL-----PMLGQS---.DVNLALVVLATGAGSVIASHVNDAGFWMFKEYFGLS-MKETFATWTLLETIIAVAGLGFTL-LLSLF
DSQ  ATGCCATTACTGATCGTAGCAATCGGG---ATTGTGGCATTATTGCTTTTGATTATGGGGTTAAAACTGAATACGTTTGTTTCCTTGATTATCGTATCGTTCGGGGTTGCATTGGCGCTTGGAATGCCGCTTGACGACATCGTCAAAACGATTGAAGAAGGCCTTGGCGGAACGCTCGGCCATATCGCATTGATCTTCGGGCTCGGCGCCATGCTGGGCAGGCTGATCGCGGATTCAGGGGGCGCTCAGCGCATTGCGATGACCCTCGTCAACAAATTCGGAGAAGAAAACATCCAATGGGCGGTCGTCATCGCCTCCTTTATCATCGGGGTAGCATTATTCTTCGAAGTCGCATTGGTATTATTGATTCCAATTGTATTCGCCATTTCAAAAGAATTGGAGATATCTATTTCATACCTTGGAATTCCAATGACGGCGGCCTTATCCGTCACACACGGCTTCCTGCCCCCGCATCCGGGACCGACGGCTATCGCGGGAGAGCTCGGCGCCAATATCGGGGAAGTGCTGCTCTACGGTATCATTGTTGCA---ATTCCAACCGTTCTTTTG---------GCCGGACCTTTATTTACGAAA---------CTGGCGAAAAAAATCGTCCCGCAATCATTTGAGAAAATGGGCAGCATCGCTTCACTCGGTGAGCAGAAAACGTTCAAGCTTGAAGAGACGCCCGGCTTCGGCATCAGCGTCTTCACAGCTATGCTTCCGGTCATTATCATGTCTATTTCGACTGTTATTACGCTTATTCAAGAAACGATGGGCCTTGCAGACAACAGCCTG...CTGGCAGCGGTTCGTTTAATCGGGAATGCCTCGACTTCGATGGTCATCTCCCTGTTGGTCGCGATCTATACGATGGGGATCGCCAGAAAGATCCCGATCAAACAAGTGATGGATTCCTGTTCAACCGCCATTACACAAATCGGAATGATGCTCTTGATCATCGGGGGCGGCGGCGCCTTCAAACAAGTCTTGATCAATGGCGGAGTAGGCGACTATGTAGCTGAATTATTCAAAGGAACAGCCATGTCGCCGATCTTGCTCGCCTGGGTCATCGCCGCAATTCTGCGCATCTCCTTAGGATCCGCGACAGTTGCTGCATTAAGCACAACCGGACTCGTTCTT---------------CCGATGCTCGGACAAAGC---------...GATGTCAATCTTGCGCTGGTTGTGCTTGCAACAGGGGCCGGAAGTGTAATCGCTTCCCATGTCAATGACGCAGGCTTCTGGATGTTCAAAGAGTATTTCGGACTAAGC---ATGAAAGAGACATTTGCCACCTGGACACTGCTTGAAACCATTATCGCGGTGGCCGGATTAGGATTTACTTTA---TTGTTAAGCCTATTT
TRN  10010101100011000
NAM  IDNT_ECOLI/1-437
ASQ  MPLIIIAAG-VALLLILMIGFKVNGFIALVLVAAVVGFAEGMDAQAVLHSIQNGIGSTLGGLAMILGFGAMLGKLISDTGAAQRIATTLIATFGKKRVQWALVITGLVVGLAMFFEVGFVLLLPLVFTIVASSGLPLLYVGVPMVAALSVTHCFLPPHPGPTAIATIFEANLGTTLLYGFIIT-IPTVIV---AGPLFSK---LLTRFEKAPPE-----G-LFNPHLFSEEEMPSFWNSIFAAVIPVILMAIAAVCEITLPKTNTVRL--.--FFEFVGNPAVALFIAIVIAIFTLGRRNGRTIEQIMDIIGDSIGAIAMIVFIIAGGGAFKQVLVDSGVGHYISHLMTGTTLSPLLMCWTVAALLRIALGSATVAAITTAGVVL-----PIINVT---.HADPALMVLATGAGSVIASHVNDPGFWLFKGYFNLT-VGETLRTWTVMETLISIMGLLGVL-AINAV
DSQ  ATGCCATTAATCATTATTGCGGCAGGC---GTCGCGCTGCTTCTTATCCTGATGATCGGCTTTAAAGTTAACGGCTTTATTGCCCTCGTTCTGGTAGCTGCCGTCGTCGGATTTGCCGAAGGGATGGATGCACAGGCCGTCCTGCACTCTATACAAAATGGTATCGGCAGCACGCTCGGCGGGCTGGCAATGATCCTCGGTTTCGGGGCCATGTTAGGCAAGCTGATTTCTGATACGGGTGCGGCACAACGTATCGCCACTACGCTGATTGCTACTTTTGGTAAAAAACGCGTGCAATGGGCGCTAGTGATCACCGGTCTGGTTGTGGGCCTCGCCATGTTTTTTGAAGTGGGTTTTGTCCTGCTGTTGCCGTTGGTATTTACCATCGTAGCATCATCAGGATTACCCCTGTTGTATGTTGGCGTACCAATGGTAGCAGCGCTCTCTGTAACCCACTGTTTTCTGCCGCCACATCCAGGGCCTACTGCCATCGCGACTATCTTTGAGGCTAATCTCGGAACGACTTTACTGTATGGATTTATCATTACC---ATTCCGACAGTTATTGTC---------GCAGGACCGCTGTTTTCTAAA---------CTGCTAACTCGCTTTGAGAAAGCACCACCGGAA---------------GGC---TTATTTAATCCTCATCTGTTTAGCGAAGAGGAGATGCCCTCCTTCTGGAACAGTATTTTCGCTGCCGTGATCCCGGTCATCCTGATGGCTATCGCCGCCGTTTGTGAAATTACGTTACCGAAAACTAACACCGTGCGCCTC------...------TTCTTTGAATTTGTCGGTAACCCTGCCGTTGCGCTGTTTATTGCCATTGTTATTGCGATTTTCACACTGGGCCGACGTAATGGACGCACCATCGAGCAAATCATGGATATCATTGGGGATTCTATAGGCGCTATCGCGATGATTGTGTTTATTATCGCTGGCGGCGGCGCGTTTAAGCAGGTATTAGTAGATAGCGGTGTCGGGCACTATATTTCACACTTAATGACCGGAACTACACTTTCGCCGTTATTGATGTGCTGGACTGTTGCGGCGCTGTTGCGTATCGCTCTGGGCTCTGCCACCGTCGCGGCCATTACCACCGCGGGTGTGGTGTTG---------------CCGATTATCAACGTTACC---------...CATGCCGATCCCGCTTTAATGGTACTGGCAACCGGTGCGGGCAGCGTGATCGCGTCACACGTAAACGACCCTGGCTTCTGGCTATTTAAAGGGTATTTTAATCTGACG---GTTGGTGAAACGTTGCGTACCTGGACGGTGATGGAAACCCTTATTTCTATTATGGGTTTGCTGGGCGTGTTA---GCCATTAACGCCGTA
TRN  10010101100011000
NAM  GNTT_ECOLI/1-437
ASQ  MPLVIVAIG-VILLLLLMIRFKMNGFIALVLVALAVGLMQGMPLDKVIGSIKAGVGGTLGSLALIMGFGAMLGKMLADCGGAQRIATTLIAKFGKKHIQWAVVLTGFTVGFALFYEVGFVLMLPLVFTIAASANIPLLYVGVPMAAALSVTHGFLPPHPGPTAIATIFNADMGKTLLYGTILA-IPTVIL---AGPVYAR---VLKGIDKPIPE------GLYSAKTFSEEEMPSFGVSVWTSLVPVVLMAMRAIAEMILPKGHAFLP--.--VAEFLGDPVMATLIAVLIAMFTFGLNRGRSMDQINDTLVSSIKIIAMMLLIIGGGGAFKQVLVDSGVDKYIASMMHETNISPLLMAWSIAAVLRIALGSATVAAITAGGIAA-----PLIATT---.GVSPELMVIAVGSGSVIFSHVNDPGFWLFKEYFNLT-IGETIKSWSMLETIISVCGLVGCL-LLNMV
DSQ  ATGCCATTAGTCATTGTTGCTATCGGT---GTAATCTTGTTGTTGCTCCTGATGATCCGCTTCAAAATGAACGGCTTCATCGCTCTCGTCCTCGTGGCGCTTGCTGTTGGATTAATGCAAGGAATGCCGCTGGATAAAGTTATTGGCTCCATCAAAGCCGGTGTCGGCGGGACGCTCGGTAGCCTTGCCCTGATCATGGGTTTTGGCGCAATGCTGGGCAAAATGCTGGCAGACTGCGGTGGCGCACAACGTATCGCCACCACGCTGATTGCCAAATTTGGTAAAAAACACATCCAGTGGGCGGTGGTACTGACCGGTTTTACCGTTGGTTTTGCCCTGTTCTATGAAGTGGGCTTTGTGCTGATGCTGCCGCTGGTGTTTACCATCGCGGCTTCTGCGAATATTCCACTGCTGTATGTTGGTGTACCAATGGCGGCTGCACTGTCTGTGACCCACGGCTTCCTGCCACCGCATCCGGGTCCGACTGCGATTGCCACCATTTTCAATGCCGATATGGGTAAAACCCTGCTGTACGGTACTATTCTGGCA---ATCCCGACCGTGATTCTC---------GCCGGTCCGGTTTACGCTCGC---------GTGTTGAAAGGTATCGATAAGCCAATTCCGGAA------------------GGTCTCTACAGCGCGAAAACCTTCAGCGAAGAAGAGATGCCGAGCTTTGGCGTCAGCGTCTGGACCTCTCTGGTGCCGGTAGTACTGATGGCGATGCGTGCGATTGCCGAAATGATCCTGCCGAAAGGTCACGCTTTCCTGCCG------...------GTAGCGGAGTTCCTCGGTGACCCGGTAATGGCAACGCTGATTGCCGTGCTGATTGCGATGTTCACCTTTGGTCTAAACCGTGGTCGTTCAATGGATCAGATTAACGACACGCTGGTTTCTTCCATCAAAATCATTGCGATGATGCTGTTGATCATCGGTGGTGGCGGTGCGTTCAAGCAGGTGCTGGTAGACAGCGGCGTGGACAAATACATTGCTTCCATGATGCACGAAACCAACATTTCTCCGCTGCTGATGGCCTGGTCGATTGCTGCCGTACTGCGTATCGCGCTGGGTTCCGCAACCGTTGCGGCAATCACTGCGGGTGGTATCGCGGCA---------------CCGCTGATTGCAACGACG---------...GGTGTTAGCCCGGAGCTGATGGTTATTGCGGTTGGTTCCGGTAGTGTGATTTTCTCTCATGTGAACGATCCGGGCTTCTGGCTGTTCAAAGAGTACTTTAACCTGACT---ATCGGCGAGACCATCAAATCCTGGTCGATGCTGGAAACCATTATCTCGGTGTGCGGTCTGGTAGGCTGTCTG---CTGCTGAATATGGTG
TRN  11011101101011000
NAM  GNUT_PSEAE/9-449
ASQ  YLLLDALVT-IIGLIVLITRFKVHPFIALIIAAGFLGLTSGMPVEKIVKSFQDGFGGVLGFVGVILALGTMLGKLMADSGGADQIARTLIRAFGKERVHWSMMLAAFLVGIPLFFEIGFILLIPLVFIVARRSGVSLIKIGIPLLAGLSAVHGLVPPHPGPLLAIGVFGADIGKTILYGLIVA-LPTAAI---AGPLFGA---LVSRYIPGTPS--AELVEQIAHEP-ETQDLPSFGVTLATVLLPVFLMLLKTFADVAFPDGHAFRA--.--WMDMIGHPISALLLALLVALYTFGYARGFDSKKILRLLDQSLAPTAAIVMIIGAGGGFKQMLVASGVGDVIGHLAVNAQISPILLAWLVAAVIRIATGSATVATITGAGIVV-----PVIDLIPG-.VNR-ELLVLATGAGSLILSHVNDAGFWLVKQYFNMS-VSETFKTWTAMETILSVVGLVFIL-LLSLV
DSQ  TACCTGCTCCTCGACGCCCTGGTGACC---ATCATCGGCCTGATCGTGCTGATCACCCGCTTCAAGGTGCATCCCTTCATCGCCCTGATCATCGCCGCCGGCTTCCTCGGCCTGACCTCGGGGATGCCGGTGGAGAAGATCGTCAAATCCTTCCAGGACGGCTTCGGCGGCGTGCTCGGCTTCGTCGGCGTGATCCTCGCCCTGGGCACCATGCTCGGCAAGCTGATGGCCGATTCCGGCGGCGCCGACCAGATCGCCCGCACCCTGATCCGCGCCTTCGGCAAGGAGCGGGTGCACTGGTCGATGATGCTCGCCGCGTTCCTGGTGGGCATCCCGCTGTTCTTCGAGATCGGCTTCATCCTGCTGATCCCGCTGGTGTTCATCGTCGCCCGGCGCAGCGGCGTGTCCCTGATCAAGATCGGCATCCCGTTGCTCGCCGGCCTTTCCGCGGTGCACGGTCTGGTGCCGCCGCATCCCGGCCCGCTGCTGGCGATCGGCGTGTTCGGCGCCGACATCGGCAAGACCATCCTCTACGGCCTGATCGTCGCC---CTGCCCACCGCCGCCATC---------GCCGGCCCGCTGTTCGGCGCG---------CTGGTCTCGCGCTACATACCCGGCACGCCATCG------GCGGAACTGGTCGAGCAGATCGCCCACGAGCCC---GAGACCCAGGACCTGCCCAGCTTCGGCGTGACCCTGGCGACCGTGCTGCTGCCGGTGTTCCTGATGCTGCTGAAGACCTTCGCCGACGTCGCCTTCCCCGATGGCCACGCGTTCCGCGCC------...------TGGATGGACATGATCGGCCATCCGATCAGCGCCCTGCTCCTGGCCCTGCTGGTGGCGCTCTATACCTTCGGCTACGCCCGTGGCTTCGACTCGAAGAAAATCCTCAGGCTGCTCGACCAGAGCCTGGCACCGACCGCCGCCATCGTGATGATCATCGGCGCCGGCGGCGGCTTCAAGCAGATGCTGGTGGCCAGCGGGGTCGGCGACGTCATCGGCCATCTCGCGGTGAACGCGCAGATCTCGCCGATCCTGCTGGCCTGGCTGGTGGCCGCGGTGATCCGCATCGCCACCGGCTCGGCCACCGTCGCCACCATCACCGGGGCCGGCATCGTGGTG---------------CCGGTGATCGACCTGATTCCCGGC---...GTCAACCGC---GAGTTGCTGGTGCTCGCCACCGGCGCCGGCTCGCTGATCCTCTCCCATGTCAACGACGCCGGGTTCTGGCTGGTCAAGCAGTACTTCAACATGAGC---GTCAGCGAGACCTTCAAGACCTGGACCGCGATGGAGACCATCCTCTCCGTGGTCGGCCTGGTCTTCATCCTG---TTGCTGTCGCTGGTG
TRN  10010101100011011
NAM  GNTP_ZYMMO/7-450
ASQ  MLLLYALAS-IIILILMIAKWRLNPFVSLILVSIGMGAVTGMPLTKVLSAFQDGLGSGIGSTASVIALGTMLGKILAESGGAERIATTTIKIFGPKLIHWAMLVIAFIVGIPIFYQVGFILLIPLVFTLGRASGISLVKLTIPLCAGLATVHGLLPPHPGSMQCVEMLHADVGKTILYGFIVG-FPAAIL---AGPLYGN---WITPRIQLPAH--NPFAESLEGSSDQDKNLPGFWLTIFSILLPVLLMVFSSGANIFLPHGNNIRA--.--FMNFMGDPVVSLLIALLVSMVTLGFWRGFSSADLLKFTNDCLGPTAGILLLIGAGGGFSEILYRAGVSNAMADLSHVMHLSPIMLGFIIAAVIRVATGSQTVAMSMSGGMLA-----PIIFSTPG-.FHSPELLVLSIGAGSSILSHVNDGAFWLLKEYLNMT-VSQTFKTWTVSVTIASIAALILTFGLQALG
DSQ  ATGCTCCTTTTATATGCATTGGCGTCC---ATCATCATTCTTATTTTGATGATTGCAAAGTGGCGTCTAAACCCTTTTGTTTCCCTTATTTTAGTTTCAATCGGTATGGGTGCCGTAACGGGCATGCCCTTAACCAAAGTTTTGTCGGCCTTTCAAGATGGTCTTGGTTCTGGTATCGGTTCCACAGCGAGTGTTATCGCACTCGGCACCATGCTTGGTAAGATCTTGGCTGAGTCTGGTGGTGCGGAACGTATCGCTACGACGACGATCAAAATCTTTGGCCCCAAACTTATCCACTGGGCGATGCTGGTCATTGCCTTTATCGTGGGTATTCCGATCTTCTATCAGGTCGGTTTTATCCTGTTGATTCCGCTCGTCTTTACCTTAGGACGTGCCAGCGGGATTTCTCTTGTCAAATTAACCATTCCGCTTTGTGCCGGTTTGGCGACCGTTCATGGTTTGCTGCCTCCGCATCCGGGTTCAATGCAATGCGTTGAAATGCTCCATGCTGATGTGGGTAAAACCATTCTTTACGGTTTCATCGTCGGT---TTCCCTGCCGCTATCCTT---------GCCGGTCCGCTTTACGGCAAT---------TGGATTACGCCTCGCATTCAGCTGCCTGCCCAC------AACCCATTTGCAGAAAGTCTTGAAGGTAGCAGCGATCAGGATAAAAATTTGCCGGGTTTCTGGCTGACGATTTTCTCGATTTTGCTTCCTGTTTTGCTGATGGTTTTTTCCAGCGGCGCCAATATCTTCCTGCCCCACGGTAACAACATTCGCGCT------...------TTCATGAACTTCATGGGTGATCCGGTTGTTTCCTTGCTTATCGCTTTGCTGGTCAGCATGGTCACCTTGGGTTTCTGGCGTGGTTTCAGCAGTGCTGATCTTCTGAAATTCACCAATGACTGCTTGGGCCCGACGGCTGGCATTCTGTTGCTGATCGGTGCTGGTGGCGGATTTAGTGAAATTCTGTATCGCGCCGGTGTCAGTAACGCCATGGCCGATCTGTCTCACGTCATGCATCTGTCCCCGATTATGCTCGGCTTTATCATTGCGGCGGTTATCCGCGTTGCAACCGGTTCACAGACGGTGGCAATGTCGATGTCCGGCGGTATGTTAGCC---------------CCGATCATCTTCAGCACCCCGGGC---...TTCCACAGCCCTGAATTGCTGGTTCTTTCGATCGGTGCCGGTTCGTCCATTCTGTCTCACGTCAATGACGGTGCTTTCTGGCTGTTAAAAGAATATCTGAATATGACG---GTCAGCCAGACCTTCAAGACCTGGACGGTTTCTGTCACCATCGCTTCGATTGCAGCCCTGATCCTCACCTTTGGTCTTCAGGCATTGGGT
TRN  11011101101011000
NAM  GNTP_ECOLI/4-446
ASQ  LNILWVVFG-IGLMLVLNLKFKINSMVALLVAALSVGMLAGMDLMSLLHTMKAGFGNTLGELAIIVVFGAVIGKLMVDSGAAHQIAHTLLARLGLRYVQLSVIIIGLIFGLAMFYEVAFIMLAPLVIVIAAEAKIPFLKLAIPAVAAATTAHSLFPPQPGPVALVNAYGADMGMVYIYGVLVT-IPSVIC---AGLILPK---FLGNLERPTPS----FL-KADQPV-DMNNLPSFGVSILVPLIPAIIMISTTIANIWLVKDTPAWE--.--VVNFIGSSPIAMFIAMVVAFVLFGTARGHDMQWVMNAFESAVKSIAMVILIIGAGGVLKQTIIDTGIGDTIGMLMSHGNISPYIMAWLITVLIRLATGQGVVSAMTAAGIISAAILDPATGQLV--.GVNPALLVLATAAGSNTLTHINDASFWLFKGYFDLS-VKDTLKTWGLLELVNSVVGLIIVL-IISMV
DSQ  CTTAACATTCTCTGGGTGGTATTCGGC---ATTGGTCTGATGCTGGTACTGAATTTGAAGTTCAAAATCAATTCAATGGTGGCTTTGTTGGTGGCGGCGCTGTCCGTCGGGATGCTGGCGGGCATGGATTTGATGTCGCTGCTGCACACTATGAAAGCGGGCTTCGGCAACACGCTGGGGGAACTGGCTATCATCGTGGTGTTCGGTGCGGTCATCGGTAAATTGATGGTCGACTCCGGCGCGGCTCACCAGATAGCGCATACGCTGCTGGCGCGTCTCGGTCTGCGCTATGTACAGCTGTCGGTGATTATCATCGGCCTGATTTTTGGTCTGGCGATGTTCTATGAAGTGGCCTTTATCATGTTAGCGCCGCTGGTTATTGTTATTGCCGCCGAAGCTAAAATTCCGTTCCTGAAACTGGCGATCCCGGCAGTAGCAGCTGCCACTACCGCACATTCACTGTTCCCACCGCAGCCGGGTCCGGTGGCGCTGGTGAATGCTTATGGCGCGGATATGGGGATGGTTTATATCTATGGCGTACTGGTGACG---ATCCCAAGTGTAATCTGC---------GCAGGTCTGATCCTGCCGAAG---------TTCCTCGGCAATCTTGAGCGCCCAACGCCATCA------------TTCCTG---AAAGCAGATCAACCGGTA---GATATGAATAATCTGCCCTCTTTCGGCGTTTCGATTCTGGTGCCGCTGATCCCGGCGATCATTATGATCTCTACCACCATCGCCAATATCTGGCTGGTAAAAGATACCCCTGCCTGGGAA------...------GTGGTTAACTTTATCGGTTCCTCGCCGATTGCAATGTTTATTGCGATGGTGGTTGCATTCGTACTCTTTGGCACCGCACGTGGTCATGACATGCAGTGGGTGATGAACGCTTTTGAAAGCGCGGTGAAGAGTATTGCAATGGTGATTCTGATCATCGGTGCGGGTGGCGTGCTGAAGCAGACCATCATCGACACCGGCATTGGCGACACCATCGGCATGTTGATGTCCCACGGCAATATCTCGCCCTACATCATGGCATGGCTGATCACTGTGCTAATTCGTCTGGCGACGGGTCAGGGTGTCGTTTCGGCGATGACCGCCGCCGGGATTATCAGTGCTGCAATCCTAGATCCAGCAACTGGTCAGCTGGTT------...GGCGTGAATCCGGCGCTGCTGGTACTGGCGACGGCTGCGGGTTCCAACACCCTCACCCACATTAACGATGCATCTTTCTGGTTGTTCAAAGGTTACTTTGACCTGTCA---GTAAAAGACACGTTGAAAACCTGGGGTCTGCTGGAGCTGGTCAACTCCGTGGTTGGGCTGATTATTGTGCTG---ATTATTAGCATGGTA
TRN  10010101100011000
NAM  DSDX_ECOLI/6-444
ASQ  WVVSTLLIS-IVLIVLTIVKFKFHPFLALLLASFFVGTMMGMGPLDMVNAIESGIGGTLGFLAAVIGLGTILGKMMEVSGAAERIGLTLQRCRWLS-VDVIMVLVGLICGITLFVEVGVVLLIPLAFSIAKKTNTSLLKLAIPLCTALMAVHCVVPPHPAALYVANKLGADIGSVIVYGLLVG-LMASLI---GGPLFLK---FLGQRLPFKPVP----TEFADLKVRDEKTLPSLGATLFTILLPIALMLVKTIAELNMARESGLYI--.--LVEFIGNPITAMFIAVFVAYYVLGIRQHMSMGTMLTHTENGFGSIANILLIIGAGGAFNAILKSSSLADTLAVILSNMHMHPILLAWLVALILHAAVGSATVAMMGATAIVA-----PMLPLYP--.DISPEIIAIAIGSGAIGCTIVTDSLFWLVKQYCGAT-LNETFKYYTTATFIASVVALAGTF-LLSFI
DSQ  TGGGTTGTGAGCACGCTGCTTATCAGC---ATCGTGTTAATTGTACTGACCATCGTGAAGTTCAAATTCCACCCGTTTCTGGCGCTGTTGCTGGCCAGCTTCTTCGTGGGAACGATGATGGGCATGGGGCCACTGGATATGGTAAATGCTATTGAAAGTGGAATTGGCGGAACGCTGGGGTTCCTCGCAGCGGTTATCGGCCTTGGCACGATACTGGGAAAAATGATGGAAGTATCCGGGGCCGCAGAAAGAATTGGTCTGACACTTCAACGCTGCCGCTGGCTTTCA---GTTGATGTCATTATGGTGCTGGTTGGCCTGATTTGTGGCATCACGCTGTTTGTTGAAGTGGGCGTCGTGCTATTGATTCCTCTGGCTTTTTCAATTGCCAAAAAAACCAATACCTCATTATTAAAGCTTGCCATTCCGCTATGTACCGCATTGATGGCAGTGCACTGCGTGGTTCCTCCACATCCGGCTGCTTTATATGTTGCCAATAAGCTGGGCGCAGATATCGGTTCGGTGATCGTCTACGGTTTGCTGGTTGGG---CTGATGGCATCACTGATC---------GGTGGCCCACTTTTCCTTAAA---------TTTCTGGGTCAACGACTGCCCTTTAAACCTGTACCC------------ACAGAGTTTGCAGATCTCAAAGTTCGCGATGAAAAAACACTACCGTCATTAGGCGCAACGTTATTCACCATACTGCTACCCATTGCGCTGATGTTGGTTAAAACGATTGCCGAATTGAATATGGCGCGTGAGAGTGGTTTGTATATC------...------TTGGTTGAGTTTATTGGCAACCCTATCACTGCCATGTTTATCGCCGTGTTTGTCGCCTATTATGTGTTGGGTATACGCCAGCATATGAGCATGGGGACGATGCTCACACATACGGAAAATGGCTTCGGTTCTATTGCTAATATTTTGCTGATTATCGGGGCCGGAGGCGCATTCAACGCCATTTTAAAAAGCAGCAGTCTCGCTGATACGCTGGCAGTTATTCTCTCCAATATGCATATGCACCCGATTCTTCTGGCCTGGTTAGTGGCTCTTATTCTGCATGCGGCAGTGGGCTCCGCTACCGTGGCAATGATGGGGGCAACGGCAATTGTTGCA---------------CCCATGCTGCCGCTGTATCCC------...GACATCAGCCCGGAAATTATTGCGATTGCTATCGGTTCAGGTGCAATTGGCTGCACTATCGTTACGGACTCGCTTTTCTGGCTAGTGAAGCAATATTGCGGCGCTACG---CTCAATGAAACATTTAAATACTATACGACAGCGACATTTATCGCTTCAGTCGTCGCTCTGGCGGGCACATTC---CTGCTGTCATTTATC
TRN  10010101100011000
NAM  GNTU_ECOLI/4-445
ASQ  LTLVLTAVGSVLLLLFLVMKARMHAFLALMVVSMGAGLFSGMPLDKIAATMEKGMGGTLGFLAVVVALGAMFGKILHETGAVDQIAVKMLKSFGHSRAHYAIGLAGLVCALPLFFEVAIVLLISVAFSMARHTGTNLVKLVIPLFAGVAAAAAFLVPGPAPMLLASQMNADFGWMILIGLCAA-IPGMII---AGPLWGN---FISRYVELHIP------DDISEPHLGEGKMPSFGFSLSLILLPLVLVGLKTIAARFVPEGSTAYE--.--WFEFIGHPFTAILVACLVAIYGLAMRQGMPKDKVMEICGHALQPAGIILLVIGAGGVFKQVLVDSGVGPALGEALTGMGLPIAITCFVLAAAVRIIQGSATVACLTAVGLVM-----PVIEQLN-YsGAQMAALSICIAGGSIVVSHVNDAGFWLFGKFTGAT-EAETLKTWTMMETILGTVGAIVGMIAFQLL
DSQ  TTAACGCTTGTTTTAACAGCAGTAGGGTCTGTTTTACTGCTGCTGTTTTTAGTCATGAAGGCGCGTATGCACGCTTTCCTGGCTTTAATGGTGGTGTCCATGGGGGCTGGCCTTTTTTCTGGTATGCCGCTCGATAAAATCGCAGCGACGATGGAAAAAGGGATGGGAGGCACCCTCGGCTTCCTGGCGGTGGTTGTCGCCCTGGGAGCTATGTTTGGCAAGATCTTACATGAAACCGGCGCAGTCGATCAGATTGCCGTCAAAATGCTCAAATCCTTCGGTCACAGCCGCGCGCATTATGCCATCGGCCTTGCGGGGCTGGTCTGTGCGCTACCGCTGTTCTTTGAAGTGGCGATAGTTCTGCTGATTAGCGTTGCTTTCTCAATGGCGCGCCACACCGGTACGAACCTGGTGAAGCTGGTAATCCCATTATTTGCAGGCGTGGCGGCAGCGGCGGCATTTCTGGTGCCTGGACCAGCGCCGATGCTGCTGGCATCGCAGATGAATGCCGACTTTGGCTGGATGATCCTGATTGGCCTGTGTGCGGCA---ATTCCGGGAATGATTATT---------GCCGGGCCGCTGTGGGGTAAC---------TTCATCAGCCGTTACGTTGAGCTGCATATTCCT------------------GACGACATCAGCGAACCGCATCTCGGCGAAGGCAAAATGCCATCTTTCGGATTCAGCCTGTCGCTGATCCTGCTGCCGCTGGTGCTGGTAGGGCTGAAAACCATTGCCGCGCGTTTTGTGCCGGAAGGATCAACTGCTTACGAA------...------TGGTTTGAGTTTATCGGTCATCCGTTTACCGCGATTCTGGTTGCTTGTCTGGTGGCGATTTACGGTCTGGCAATGCGTCAGGGCATGCCAAAAGACAAAGTGATGGAGATTTGCGGTCACGCGCTGCAACCGGCGGGGATCATTCTGCTGGTGATTGGTGCGGGCGGCGTGTTCAAACAGGTGCTGGTTGACTCTGGCGTAGGTCCGGCACTGGGCGAAGCGTTAACCGGCATGGGCCTGCCGATTGCTATCACCTGCTTCGTGCTGGCAGCTGCAGTGCGCATCATTCAGGGTTCTGCCACCGTAGCCTGTTTAACGGCGGTAGGACTGGTGATG---------------CCGGTTATTGAACAACTGAAC---TACtccGGTGCGCAAATGGCGGCGCTGTCGATTTGTATCGCTGGTGGTTCGATTGTTGTCAGCCACGTTAACGACGCCGGTTTCTGGTTGTTCGGTAAATTTACCGGCGCGACC---GAAGCCGAAACGCTGAAAACCTGGACCATGATGGAAACCATCCTCGGCACTGTCGGTGCCATCGTTGGGATGATTGCGTTCCAGCTGTTG
TRN  10010101100011000
NAM  YGBN_ECOLI/4-454
ASQ  ITLLCIALAGVIMLLLLVIKAKVQPFVALLLVSLLVALAAGIPAGEVGKVMIAGMGGVLGSVTIIIGLGAMLGRMIEHSGGAESLANYFSRKLGDKRTIAALTLAAFFLGIPVFFDVGFIILAPIIYGFAKVAKISPLKFGLPVAGIMLTVHVAVPPHPGPVAAAGLLHADIGWLTIIGIAIS-IPVGVVGYFAAKIINKRQ-YAMSVEVLEQMQLAPASEEGATKLSDKINPPGVALVTSLIVIPIAIIMAGTVSATLMPPSHPLLG--.--TLQLIGSPMVALMIALVLAFWLLALRRGWSLQHTSDIMGSALPTAAVVILVTGAGGVFGKVLVESGVGKALANMLQMIDLPLLPAAFIISLALRASQGSATVAILTTGGLLS-----EAVMGLN--.PIQCVLVTLAACFGGLGASHINDSGFWIVTKYLGLS-VADGLKTWTVLTTILGFTGFLITWCVWAVI
DSQ  ATTACATTGTTATGCATTGCGTTAGCTGGCGTAATCATGCTGTTGCTGCTGGTCATCAAGGCAAAGGTACAACCATTCGTTGCTTTGCTCCTCGTCAGCCTGTTAGTCGCACTTGCGGCAGGTATACCGGCGGGCGAAGTGGGTAAAGTGATGATCGCCGGGATGGGCGGTGTGCTTGGTTCCGTCACTATTATTATTGGTCTGGGCGCTATGCTGGGGCGTATGATCGAACACTCTGGTGGTGCAGAGTCACTGGCTAATTATTTCAGTCGCAAGTTAGGTGACAAACGAACTATCGCTGCGCTGACTCTGGCAGCGTTCTTCCTCGGTATTCCCGTCTTCTTTGATGTCGGCTTTATTATTCTTGCGCCAATCATTTACGGTTTTGCCAAGGTTGCCAAAATATCGCCACTCAAATTTGGCCTGCCTGTCGCTGGGATCATGCTCACTGTTCACGTGGCGGTACCGCCGCATCCAGGCCCTGTCGCCGCAGCGGGGTTACTCCACGCAGACATCGGCTGGCTAACCATCATCGGTATTGCGATTTCT---ATTCCCGTAGGGGTTGTTGGCTACTTTGCAGCGAAAATAATCAATAAGCGCCAA---TATGCGATGTCAGTAGAAGTACTGGAACAGATGCAACTGGCTCCGGCCAGTGAGGAAGGCGCGACAAAATTAAGCGATAAAATAAATCCACCGGGCGTCGCGCTGGTCACCTCGCTAATTGTTATTCCTATCGCGATTATCATGGCGGGTACGGTTTCCGCAACACTGATGCCGCCTTCGCATCCCCTGCTTGGT------...------ACGCTACAGCTGATCGGCTCACCAATGGTAGCTCTAATGATTGCGCTGGTGCTGGCATTCTGGTTATTGGCTTTACGTCGCGGCTGGAGCTTACAACACACCAGCGACATTATGGGCTCAGCGCTTCCTACTGCGGCGGTAGTGATTTTGGTTACTGGTGCTGGAGGGGTATTTGGCAAAGTGCTGGTGGAATCGGGCGTCGGCAAAGCCCTTGCCAACATGCTACAAATGATTGACCTGCCTCTGTTACCAGCCGCATTTATTATTTCACTGGCGCTGCGTGCATCGCAGGGGTCAGCAACCGTAGCAATACTGACAACCGGCGGGTTACTCTCA---------------GAAGCGGTGATGGGATTGAAT------...CCGATTCAGTGCGTATTGGTGACGCTGGCAGCCTGCTTTGGTGGGCTTGGTGCGTCACATATTAATGACTCAGGGTTCTGGATTGTGACCAAATATCTGGGGTTGTCG---GTAGCAGACGGTCTGAAAACCTGGACAGTGTTAACGACCATTCTCGGTTTTACCGGATTCTTAATTACCTGGTGCGTATGGGCGGTAATT
TRN  10010101100011000
NAM  Y1015_HAEIN/6-457
ASQ  IPIIGLLIA-VFVLVFLVLRTRVHAFIAMLIAASIAGLVGGMSADETLNSITKGFGGTLGSIGIVIGLGVMMGSVLEVSGAAEKMAYSFIKMLGQKKEEWALAITGYVVSIPIFVDSAFVILYPVAKALAKNGKRSLLTLGVALAGGLAVTHHTVPPTPGPLGVAGLFGVDIGAMLLTGMCMAFLPVVGIVLYAKWLDKKYPNFNQEVFTEEELK---QKYDSYIESREKKELPSLGLSLLPIVLPIVLIFIKAVVHLFVKDVPEALTSIpYQIVSFLGHPVIVLALSVLISVYTLLPKADKNTTALH--LEEGVKTAGIILLVTGAGGALGAVLRDSGAGKQLAEQIANLPISPILIPFIVSTLVRFIQGSGTVAMITAASISS-----PILAQIP--.GVNMLLAAQAATMGSLFFGYFNDSLFWVVNRMMGINDVKKQMVVWSVPTTIAWGIGGISVI-LANLI
DSQ  ATTCCAATTATTGGATTATTAATCGCT---GTATTTGTTCTCGTTTTTCTCGTATTAAGAACGCGAGTTCATGCTTTCATCGCAATGCTAATTGCAGCTTCAATTGCAGGTTTAGTAGGTGGTATGTCAGCTGATGAAACCTTAAATTCCATCACAAAAGGATTTGGTGGCACACTAGGTAGTATTGGGATTGTTATCGGACTTGGTGTAATGATGGGTAGCGTCTTAGAAGTTTCTGGTGCGGCAGAAAAAATGGCATATAGTTTTATCAAAATGCTAGGTCAGAAAAAAGAAGAATGGGCATTAGCTATTACAGGTTACGTAGTGAGTATTCCAATTTTCGTAGATTCTGCATTTGTTATCCTTTATCCAGTAGCAAAAGCTCTCGCAAAAAATGGTAAACGCTCATTATTAACTCTAGGCGTTGCTTTGGCTGGTGGCTTGGCTGTGACACACCACACCGTTCCACCAACACCAGGTCCATTGGGAGTAGCTGGGTTATTTGGTGTAGATATTGGTGCAATGTTACTCACTGGAATGTGTATGGCTTTCTTGCCTGTTGTAGGAATAGTTCTGTATGCTAAATGGTTAGATAAAAAATACCCTAACTTTAATCAAGAAGTGTTCACGGAAGAAGAATTAAAA---------CAAAAATATGATAGTTATATTGAAAGTCGTGAGAAAAAAGAACTTCCTAGTTTAGGGCTTTCTTTACTACCAATTGTATTACCGATAGTATTAATCTTTATTAAAGCAGTTGTACATTTATTCGTTAAAGATGTACCTGAAGCATTGACAAGTATAcctTATCAAATCGTTTCATTCCTTGGTCACCCTGTTATTGTTTTAGCATTAAGCGTATTAATTTCTGTTTACACATTATTACCAAAAGCCGATAAAAATACGACTGCACTTCAT------CTTGAAGAAGGTGTTAAAACAGCTGGTATTATCTTATTAGTAACAGGTGCGGGTGGTGCATTAGGTGCGGTATTACGCGATAGTGGTGCTGGAAAACAATTAGCAGAACAGATCGCAAACTTACCTATTTCACCAATTTTAATTCCATTTATCGTATCGACCTTAGTGCGTTTTATTCAAGGTTCAGGTACGGTTGCAATGATTACAGCTGCTTCAATTTCATCC---------------CCAATCCTTGCACAAATACCT------...GGTGTCAATATGCTATTAGCCGCTCAAGCTGCTACCATGGGATCGCTTTTCTTTGGCTATTTCAATGATAGTTTATTCTGGGTGGTTAACCGTATGATGGGAATTAATGATGTGAAAAAACAAATGGTCGTTTGGTCTGTACCAACCACGATTGCTTGGGGGATTGGTGGTATTTCAGTAATT---CTGGCTAACTTGATT
TRN  10010101100011000
//