EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02404 - SCF)
FAM  PF02404
PID  SCF
DES  Stem cell factor
IPR  IPR003452
ANO  4
ALN  288
AID  0.687894
APH  ((SCF_RAT/1-273:0.08350,SCF_PIG/1-274:0.11720):0.56477,SCF_COTJA/1-287:0.01084,SCF_CHICK/1-287:0.00683);
ATP  ((SCF_RAT/1-273,SCF_PIG/1-274),SCF_COTJA/1-287,SCF_CHICK/1-287);
ATL  0.78314
DNO  4
DLN  864
DID  0.756251
DPH  ((SCF_RAT/1-273:0.07584,SCF_PIG/1-274:0.06659):0.37032,SCF_COTJA/1-287:0.01426,SCF_CHICK/1-287:0.01541);
DTP  ((SCF_RAT/1-273,SCF_PIG/1-274),SCF_COTJA/1-287,SCF_CHICK/1-287);
DTL  0.54242
RID  0.687894
RPH  ((SCF_RAT/1-273:0.08350,SCF_PIG/1-274:0.11720):0.56477,SCF_COTJA/1-287:0.01084,SCF_CHICK/1-287:0.00683);
RTP  ((SCF_RAT/1-273,SCF_PIG/1-274),SCF_COTJA/1-287,SCF_CHICK/1-287);
RTL  0.78314
LNK  SCF_CHICK/1-287:Q09108:D13516
LNK  SCF_COTJA/1-287:Q90314:U43078
LNK  SCF_PIG/1-274:Q29030:L07786
LNK  SCF_RAT/1-273:P21581:AF071204
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SCF_PIG/1-274
ASQ  MKKTQTWIITCIYLQLLLFNPLVRTQGICRNRVTDDVKDVTKLVANLPKDYKITLKYVPGMDVLPSHCWISEMVEQLSVSLTDLLDKFSNISEG---LSNYSIIDKLVKIVDDLVECMEEHSFEN-VKKSSKSPEPRLFTPEKFFGIFNRSIDAFKDLEMVAPKTSECVI-SSTLTPEKDSRVSVTKPFMLPPVAASSLRNDS------SSSNRKASDSIEDSSLQWAAVALPAFFSLVIGFAFGALYWKKKQP-NLTRTVENIQIN--EEDNEISMLQEKEREFQEV
DSQ  ATGAAGAAGACACAAACTTGGATTATCACTTGCATTTATCTTCAACTGCTCCTATTTAATCCTCTCGTCAGAACTCAAGGGATCTGCAGGAACCGTGTGACTGATGATGTGAAAGACGTTACAAAATTGGTGGCAAATCTTCCAAAAGACTATAAGATAACCCTCAAATATGTCCCCGGGATGGACGTTTTGCCTAGTCATTGTTGGATAAGCGAAATGGTGGAACAACTGTCAGTCAGCTTGACTGATCTTCTGGACAAGTTTTCCAATATTTCTGAAGGC---------TTGAGTAATTATTCTATCATAGACAAACTTGTGAAAATTGTTGATGACCTCGTGGAATGCATGGAAGAACACTCATTTGAGAAT---GTAAAAAAATCATCTAAGAGCCCAGAACCCAGGCTGTTTACTCCTGAAAAATTCTTTGGGATTTTTAATAGATCCATCGATGCCTTCAAGGATTTGGAGATGGTGGCACCTAAAACTAGTGAATGTGTGATT---TCTTCAACATTAACTCCTGAAAAAGATTCCAGAGTCAGTGTCACAAAACCATTTATGTTACCCCCTGTTGCAGCCAGCTCCCTTAGGAATGACAGC------------------AGTAGCAGTAATAGGAAGGCCTCAGATTCCATTGAAGACTCCAGCCTCCAGTGGGCAGCCGTAGCATTGCCAGCATTCTTCTCTCTTGTCATTGGGTTTGCTTTTGGAGCCTTATACTGGAAGAAGAAACAACCA---AACCTTACAAGGACAGTGGAAAATATACAGATTAAT------GAAGAGGATAATGAGATAAGTATGTTGCAAGAAAAAGAGAGAGAGTTTCAAGAAGTG
TRN  10010101100011000
NAM  SCF_RAT/1-273
ASQ  MKKTQTWIITCIYLQLLLFNPLVKTQEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEG---LSNYSIIDKLGKIVDDLVACMEENAPKN-VKESLKKPETRNFTPEEFFSIFNRSIDAFKD-FMVASDTSDCVL-SSTLGPEKDSRVSVTKPFMLPPVAASSLRNDS------SSSNRKAAKSPEDPGLQWTAMALPALISLVIGFAFGALYWKKKQS-SLTRAVENIQIN--EEDNEISMLQQKEREFQEV
DSQ  ATGAAGAAGACACAAACTTGGATTATCACTTGCATTTATCTTCAACTGCTCCTATTTAATCCTCTCGTCAAAACTCAGGAGATCTGCAGGAATCCTGTGACTGATAATGTAAAAGACATTACAAAACTGGTGGCGAATCTTCCAAATGACTATATGATAACCCTCAACTATGTCGCCGGGATGGATGTTTTGCCTAGTCATTGTTGGTTACGAGATATGGTAACACACTTATCAGTCAGCTTGACTACTCTTCTGGACAAGTTTTCAAATATTTCTGAAGGC---------TTGAGTAATTATTCCATCATAGACAAACTTGGGAAAATAGTGGATGACCTCGTGGCATGTATGGAAGAAAATGCACCTAAGAAT---GTAAAAGAATCACTGAAGAAGCCAGAAACTAGAAACTTTACTCCTGAAGAATTCTTTAGTATTTTCAATAGATCCATTGATGCCTTCAAGGAC---TTCATGGTGGCATCTGACACTAGTGATTGTGTGCTC---TCTTCAACATTAGGTCCTGAGAAAGATTCCAGAGTCAGTGTCACAAAACCATTTATGTTACCCCCTGTTGCAGCCAGTTCCCTTAGGAATGACAGC------------------AGTAGCAGTAATAGGAAAGCCGCAAAGTCCCCTGAAGACCCGGGCCTACAATGGACAGCAATGGCACTGCCGGCTCTCATTTCGCTTGTAATTGGCTTTGCTTTTGGAGCCTTATACTGGAAGAAGAAACAGTCA---AGTCTTACAAGGGCAGTTGAAAATATACAGATTAAT------GAAGAGGATAATGAGATAAGTATGTTGCAACAGAAAGAGAGAGAATTTCAAGAGGTG
TRN  10010101100011000
NAM  SCF_CHICK/1-287
ASQ  MKKAQTWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLVGNLPNDYLITLKYVPKMDSLPNHCWLHLMVPEFSRSLHNLLQKFSDISDMSDVLSNYSIINNLTRIINDLMACLAFDKNKDFIKENGHLYEEDRFIPENFFRLFNSTIEVYKE-FADSLDKNDCIMPSTVETPENDSRVAVTKTISFPPVAASSLRNDSIGSNTSSNSNKEALGFISSSSLQGISIALTSLLSLLIGFILGAIYWKKTHPKSRPESNETIQCHGCQEENEISMLQQKEKEHLQV
DSQ  ATGAAGAAGGCACAAACTTGGATTATCACTTGCTTTTGTCTTCAACTACTCCTACTTAATCCTCTTGTCAAAGCCCAGAGTTCCTGCGGGAATCCAGTGACAGATGATGTAAATGATATTGCAAAATTGGTTGGAAATCTCCCAAATGATTATCTGATAACCCTTAAATATGTCCCGAAGATGGATAGCCTGCCTAATCACTGTTGGTTGCATTTGATGGTGCCTGAATTTTCAAGGAGTCTACATAATCTTCTCCAGAAATTTTCAGATATTTCCGATATGTCTGATGTTTTAAGCAACTATTCAATCATTAATAACCTCACAAGGATAATCAATGATCTTATGGCATGTTTAGCTTTTGATAAAAATAAGGATTTTATAAAAGAAAATGGTCACCTTTATGAAGAAGATCGTTTCATTCCTGAGAATTTTTTTAGGCTCTTTAATAGTACCATTGAGGTCTACAAGGAG---TTTGCAGATTCATTGGATAAGAACGACTGCATTATGCCTTCAACTGTAGAAACACCAGAGAATGATTCCAGAGTCGCTGTCACAAAAACAATTTCGTTTCCTCCTGTTGCTGCCAGCTCCCTTAGGAATGACAGCATTGGCAGTAATACTAGCAGTAACAGTAACAAAGAGGCACTTGGCTTCATTAGCAGCTCCAGCCTGCAAGGGATCAGCATAGCATTGACATCATTGCTGTCTCTTCTCATTGGCTTTATTCTGGGAGCCATATACTGGAAGAAAACACATCCTAAGTCCAGACCAGAAAGTAATGAAACTATACAGTGTCATGGTTGTCAAGAGGAAAATGAGATAAGTATGTTGCAGCAAAAAGAAAAAGAACATCTACAAGTG
TRN  10010101100011000
NAM  SCF_COTJA/1-287
ASQ  MKKAQTWIITCFCLQLLLLNPLVKTQSSCGNPVTDDVNDIAKLVGNLPNDYLITLKYVPKMDSLPNHCWLHLMVPEFSRSLHNLLQKFVDISDMSDVLSNYSIINNLTRIINDLMACLAFDKNKDFIKENGHLYEEDRFIPENFFRLFNRTIEVYKE-FADSLDKNDCIMPSTVETPENDSRVAVTKTISFPPVAASSLRNDSIGSNTSSNSNKEALGFISSSSLQGISIALTSLLSLLIGFILGVIYWKKTHPKSRPESNETTQCHGCQEENEISMLQQKEKEHLQV
DSQ  ATGAAGAAGGCACAAACTTGGATTATCACTTGCTTTTGTCTTCAACTACTCTTACTTAATCCTCTTGTCAAAACCCAGAGTTCCTGCGGGAATCCAGTGACAGATGACGTAAATGATATTGCAAAATTGGTTGGAAATCTCCCAAATGATTATCTGATAACCCTTAAATATGTCCCGAAGATGGATAGCCTGCCTAATCACTGTTGGTTGCATTTGATGGTGCCTGAATTTTCAAGGAGTCTACATAATCTTCTCCAGAAATTTGTGGATATTTCTGATATGTCTGATGTTTTAAGCAATTATTCAATCATTAATAACCTCACAAGAATAATCAATGATCTTATGGCATGTCTAGCTTTTGATAAAAATAAGGATTTTATAAAAGAAAATGGTCACCTTTATGAAGAAGATCGCTTCATTCCTGAGAATTTTTTTAGGCTCTTTAATAGGACCATTGAGGTCTACAAGGAG---TTTGCAGACTCACTAGATAAGAATGACTGCATTATGCCTTCAACTGTAGAAACTCCAGAGAATGATTCCAGAGTCGCTGTCACAAAAACAATTTCGTTTCCTCCTGTTGCTGCCAGCTCCCTTAGGAATGACAGCATTGGCAGTAATACTAGCAGTAACAGTAACAAAGAGGCACTTGGCTTCATTAGCAGCTCCAGCCTGCAAGGGATCAGCATAGCATTGACATCATTGCTATCTCTTCTCATTGGCTTTATTTTGGGAGTGATATACTGGAAGAAGACACATCCTAAATCCAGACCAGAAAGTAACGAAACTACACAGTGTCATGGTTGTCAAGAGGAAAATGAGATAAGTATGTTGCAGCAAAAAGAAAAAGAACATCTACAAGTG
TRN  10010101100011000
//