EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02375 - JmjN)
FAM  PF02375
PID  JmjN
DES  jmjN domain
IPR  IPR003349
ANO  11
ALN  55
AID  0.381193
APH  (((RBBP2_HUMAN/18-64:0.18557,JD1C_HUMAN/13-59:0.07705):0.29560,((O64752_ARATH/60-106:0.02533,Q9ZV12_ARATH/93-139:0.98315):0.15415,JMJ_MOUSE/554-600:0.62839):0.19782):0.11966,(YJ89_YEAST/3-51:0.70114,Q23541_CAEEL/55-101:0.19558):0.15397,((RPH1_YEAST/13-59:0.28601,GIS1_YEAST/11-63:0.61182):0.23557,(O75274_HUMAN/14-61:0.00000,JMJ2A_HUMAN/13-60:0.23881):0.56121):0.58061);
ATP  (((RBBP2_HUMAN/18-64,JD1C_HUMAN/13-59),((O64752_ARATH/60-106,Q9ZV12_ARATH/93-139),JMJ_MOUSE/554-600)),(YJ89_YEAST/3-51,Q23541_CAEEL/55-101),((RPH1_YEAST/13-59,GIS1_YEAST/11-63),(O75274_HUMAN/14-61,JMJ2A_HUMAN/13-60)));
ATL  6.23144
DNO  11
DLN  165
DID  0.455983
DPH  ((YJ89_YEAST/3-51:0.42973,(Q23541_CAEEL/55-101:0.26250,((RBBP2_HUMAN/18-64:0.21136,JD1C_HUMAN/13-59:0.15386):0.18999,((O64752_ARATH/60-106:0.13769,Q9ZV12_ARATH/93-139:0.72411):0.12615,JMJ_MOUSE/554-600:0.50169):0.12431):0.14309):0.12287):0.15795,(O75274_HUMAN/14-61:0.24319,JMJ2A_HUMAN/13-60:0.11223):0.46096,(RPH1_YEAST/13-59:0.42509,GIS1_YEAST/11-63:0.31980):0.16239);
DTP  ((YJ89_YEAST/3-51,(Q23541_CAEEL/55-101,((RBBP2_HUMAN/18-64,JD1C_HUMAN/13-59),((O64752_ARATH/60-106,Q9ZV12_ARATH/93-139),JMJ_MOUSE/554-600)))),(O75274_HUMAN/14-61,JMJ2A_HUMAN/13-60),(RPH1_YEAST/13-59,GIS1_YEAST/11-63));
DTL  5.00896
RID  0.381193
RPH  (((RBBP2_HUMAN/18-64:0.18557,JD1C_HUMAN/13-59:0.07705):0.29560,((O64752_ARATH/60-106:0.02533,Q9ZV12_ARATH/93-139:0.98315):0.15415,JMJ_MOUSE/554-600:0.62839):0.19782):0.11966,(YJ89_YEAST/3-51:0.70114,Q23541_CAEEL/55-101:0.19558):0.15397,((RPH1_YEAST/13-59:0.28601,GIS1_YEAST/11-63:0.61182):0.23557,(O75274_HUMAN/14-61:0.00000,JMJ2A_HUMAN/13-60:0.23881):0.56121):0.58061);
RTP  (((RBBP2_HUMAN/18-64,JD1C_HUMAN/13-59),((O64752_ARATH/60-106,Q9ZV12_ARATH/93-139),JMJ_MOUSE/554-600)),(YJ89_YEAST/3-51,Q23541_CAEEL/55-101),((RPH1_YEAST/13-59,GIS1_YEAST/11-63),(O75274_HUMAN/14-61,JMJ2A_HUMAN/13-60)));
RTL  6.23144
LNK  GIS1_YEAST/11-63:Q03833:Z47746
LNK  JD1C_HUMAN/13-59:P41229:L25270
LNK  JMJ2A_HUMAN/13-60:O75164:BC002558
LNK  JMJ_MOUSE/554-600:Q62315:D31967
LNK  O64752_ARATH/60-106:O64752:AC004238
LNK  O75274_HUMAN/14-61:O75274:AC005595
LNK  Q23541_CAEEL/55-101:Q23541:Z69385
LNK  Q9ZV12_ARATH/93-139:Q9ZV12:AC005770
LNK  RBBP2_HUMAN/18-64:P29375:S66431
LNK  RPH1_YEAST/13-59:P39956:U18922
LNK  YJ89_YEAST/3-51:P47156:Z49619
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9ZV12_ARATH/93-139
ASQ  YYVYLFPLYLHIEDTLSYISS--LRDRAEPYGICCVVPPPSW------KPPCLLK
DSQ  TACTATGTCTACCTCTTTCCTCTCTATCTTCATATAGAGGACACACTCTCATATATATCAAGC------TTGCGTGACAGAGCTGAGCCGTATGGAATCTGTTGTGTTGTTCCTCCACCTTCATGG------------------AAACCTCCATGTCTTCTCAAG
TRN  10010101110011001
NAM  JMJ_MOUSE/554-600
ASQ  EIPVLRPSAKEFHDPLIYIES--VRAQVEKYGMCRVIPPPDW------RPECKLN
DSQ  GAGATCCCTGTCCTCAGGCCCTCCGCCAAGGAGTTCCACGACCCGCTCATCTACATCGAGTCA------GTACGTGCTCAGGTGGAGAAGTACGGGATGTGTCGCGTGATTCCCCCTCCAGACTGG------------------CGGCCAGAGTGCAAGCTCAAC
TRN  10010101110011001
NAM  O64752_ARATH/60-106
ASQ  EAPVFHPTSEEFEDTLAYIEK--IRPLAESFGICRIVPPSNW------SPPCRLK
DSQ  GAAGCTCCAGTATTCCACCCTACATCAGAGGAGTTTGAAGATACGCTTGCTTACATAGAAAAA------ATACGTCCCTTAGCTGAATCATTTGGTATTTGTCGAATCGTGCCACCGTCGAATTGG------------------TCTCCTCCTTGCCGGCTTAAA
TRN  10010101110011000
NAM  JD1C_HUMAN/13-59
ASQ  ECPVFEPSWAEFRDPLGYIAK--IRPIAEKSGICKIRPPADW------QPPFAVE
DSQ  GAGTGCCCGGTGTTCGAGCCTAGCTGGGCCGAGTTCCGAGACCCTCTTGGCTACATCGCGAAA------ATCAGGCCCATCGCAGAGAAATCGGGCATTTGCAAGATCCGCCCACCCGCGGACTGG------------------CAGCCACCCTTTGCTGTGGAA
TRN  10010101110011011
NAM  RBBP2_HUMAN/18-64
ASQ  ECPVFEPSWEEFTDPLSFIGR--IRPLAEKTGICKIRPPKDW------QPPFACE
DSQ  GAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACAGATCCGCTCAGCTTTATCGGCCGC------ATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGG------------------CAGCCTCCATTTGCCTGTGAA
TRN  11011101111011011
NAM  Q23541_CAEEL/55-101
ASQ  MAPIYYPTEEEFSDPIEYVAK--IRHEAEKFGVVKIVPPANF------KPPFAID
DSQ  ATGGCTCCAATTTACTACCCGACAGAAGAAGAGTTCTCAGATCCAATCGAGTATGTTGCCAAA------ATACGACACGAGGCCGAAAAATTTGGAGTTGTTAAAATTGTTCCGCCGGCGAATTTC------------------AAACCACCGTTTGCTATCGAC
TRN  10010101110011001
NAM  YJ89_YEAST/3-51
ASQ  EIPALYPTEQEFKNPIDYLSNPHIKRLGVRYGMVKVVPPNGF------CPPLSID
DSQ  GAAATTCCTGCCCTGTATCCAACGGAACAAGAATTCAAAAATCCGATCGATTATCTCTCTAACCCCCACATTAAAAGGCTTGGTGTACGATATGGTATGGTCAAGGTCGTACCACCAAACGGGTTC------------------TGCCCGCCACTTTCTATTGAT
TRN  10010101100011011
NAM  JMJ2A_HUMAN/13-60
ASQ  RIMTFYPTMEEFRNFSRYIAYI-ESQGAHRAGLAKVVPPKEW------KPRASYD
DSQ  AGGATAATGACCTTTTATCCAACTATGGAAGAGTTCCGAAACTTCAGTAGATACATTGCCTACATT---GAATCCCAAGGAGCTCATCGGGCAGGGCTAGCCAAGGTTGTTCCTCCAAAAGAGTGG------------------AAGCCACGAGCATCCTATGAT
TRN  10010101110011011
NAM  O75274_HUMAN/14-61
ASQ  KIMTFRPTMEEFKDFNKYVAYI-ESQGAHRAGLAKIIPPKEW------KPRQTYD
DSQ  AAAATCATGACGTTTCGCCCAACCATGGAAGAATTTAAAGACTTCAACAAATACGTGGCCTACATA---GAGTCGCAGGGAGCCCACCGGGCGGGCCTGGCCAAGATCATCCCCCCGAAGGAGTGG------------------AAGCCGCGGCAGACGTATGAT
TRN  10010101100011011
NAM  GIS1_YEAST/11-63
ASQ  GVPVFKPSMMEFANFQYFIDEI-TKFG-IENGIVKVIPPKEWLELLEGSPPAESL
DSQ  GGCGTTCCGGTTTTTAAGCCGTCTATGATGGAGTTTGCAAATTTCCAATATTTCATTGATGAAATT---ACTAAATTCGGA---ATAGAAAATGGTATTGTCAAAGTCATTCCTCCCAAAGAATGGCTGGAGCTTTTAGAAGGCTCACCTCCTGCGGAAAGTTTA
TRN  10010101100011000
NAM  RPH1_YEAST/13-59
ASQ  GVPVFKPTYEQFEDFYAYCKAI-NKYG-MKSGVVKVIPPKEW------KDKLDLP
DSQ  GGAGTGCCCGTCTTCAAACCCACATACGAGCAATTCGAAGATTTCTATGCATACTGCAAGGCCATA---AACAAATATGGC---ATGAAAAGTGGTGTTGTGAAAGTAATCCCACCTAAAGAATGG------------------AAAGACAAATTAGATCTGCCT
TRN  10010101100011010
//