EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02357 - NusG)
FAM  PF02357
PID  NusG
DES  Transcription termination factor nusG
IPR  IPR001062
ANO  14
ALN  45
AID  0.376784
APH  ((((((NUSG_THETH/2-45:0.41884,((NUSG_SYNY3/20-63:0.69303,(NUSG_STRCO/110-153:0.24835,NUSG_MYCTU/46-89:0.12971):0.09729):0.24399,(NUSG_BACSU/2-45:0.00000,NUSG_STAAM/7-50:0.24210):0.11580):0.10425):0.21394,NUSG_THEMA/2-45:0.49405):0.08638,(NUSG_HELPY/1-44:0.54647,NUSG_CHLTR/1-44:0.47034):0.34289):0.17094,(NUSG_BORBU/2-45:0.83464,NUSG_TREPA/2-46:0.51799):0.58763):0.07641,NUSG_RICPR/17-60:0.81301):0.53381,NUSG_ECOLI/5-48:0.02136,NUSG_HAEIN/9-52:0.25842);
ATP  ((((((NUSG_THETH/2-45,((NUSG_SYNY3/20-63,(NUSG_STRCO/110-153,NUSG_MYCTU/46-89)),(NUSG_BACSU/2-45,NUSG_STAAM/7-50))),NUSG_THEMA/2-45),(NUSG_HELPY/1-44,NUSG_CHLTR/1-44)),(NUSG_BORBU/2-45,NUSG_TREPA/2-46)),NUSG_RICPR/17-60),NUSG_ECOLI/5-48,NUSG_HAEIN/9-52);
ATL  8.23385
DNO  13
DLN  135
DID  0.472319
DPH  (NUSG_THEMA/2-45:0.27807,((NUSG_SYNY3/20-63:0.43823,(NUSG_STRCO/110-153:0.19211,NUSG_MYCTU/46-89:0.15084):0.13581):0.25406,(NUSG_BACSU/2-45:0.09136,NUSG_STAAM/7-50:0.26642):0.08436):0.21965,((NUSG_BORBU/2-45:0.54787,NUSG_TREPA/2-46:0.42888):0.16089,(((NUSG_ECOLI/5-48:0.14830,NUSG_HAEIN/9-52:0.19493):0.34529,NUSG_RICPR/17-60:0.35269):0.17463,(NUSG_HELPY/1-44:0.34167,NUSG_CHLTR/1-44:0.41348):0.10955):0.12839):0.12095);
DTP  (NUSG_THEMA/2-45,((NUSG_SYNY3/20-63,(NUSG_STRCO/110-153,NUSG_MYCTU/46-89)),(NUSG_BACSU/2-45,NUSG_STAAM/7-50)),((NUSG_BORBU/2-45,NUSG_TREPA/2-46),(((NUSG_ECOLI/5-48,NUSG_HAEIN/9-52),NUSG_RICPR/17-60),(NUSG_HELPY/1-44,NUSG_CHLTR/1-44))));
DTL  5.57844
RID  0.372517
RPH  ((((((NUSG_STAAM/7-50:0.07747,(NUSG_BACSU/2-45:0.03111,(NUSG_SYNY3/20-63:0.68427,(NUSG_STRCO/110-153:0.21162,NUSG_MYCTU/46-89:0.16995):0.09989):0.34370):0.13852):0.23040,NUSG_THEMA/2-45:0.47421):0.20801,(NUSG_HELPY/1-44:0.50901,NUSG_CHLTR/1-44:0.50418):0.32418):0.06569,(NUSG_BORBU/2-45:0.91248,NUSG_TREPA/2-46:0.42966):0.51238):0.07733,NUSG_RICPR/17-60:0.78330):0.59250,NUSG_ECOLI/5-48:0.00000,NUSG_HAEIN/9-52:0.27815);
RTP  ((((((NUSG_STAAM/7-50,(NUSG_BACSU/2-45,(NUSG_SYNY3/20-63,(NUSG_STRCO/110-153,NUSG_MYCTU/46-89)))),NUSG_THEMA/2-45),(NUSG_HELPY/1-44,NUSG_CHLTR/1-44)),(NUSG_BORBU/2-45,NUSG_TREPA/2-46)),NUSG_RICPR/17-60),NUSG_ECOLI/5-48,NUSG_HAEIN/9-52);
RTL  7.69561
LNK  NUSG_BACSU/2-45:Q06795:D13303
LNK  NUSG_BORBU/2-45:O51355:AE001145
LNK  NUSG_CHLTR/1-44:O84322:AE001305
LNK  NUSG_ECOLI/5-48:P16921:M30610
LNK  NUSG_HAEIN/9-52:P43916:U32754
LNK  NUSG_HELPY/1-44:P55976:AE000626
LNK  NUSG_MYCTU/46-89:P65589:BX842574
LNK  NUSG_RICPR/17-60:P50056:Z54171
LNK  NUSG_STAAM/7-50:O08386:AP003359
LNK  NUSG_STRCO/110-153:P36266:D32254
LNK  NUSG_SYNY3/20-63:P36265:X72627
LNK  NUSG_THEMA/2-45:P29397:Z11839
LNK  NUSG_THETH/2-45:P35872:
LNK  NUSG_TREPA/2-46:O83264:AE001205
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  NUSG_CHLTR/1-44
ASQ  MFKWYVVQVFTAQEKKVKKSLEDFKE-ASGMSDFIQQIILPSENV
DSQ  ATGTTTAAGTGGTATGTCGTCCAAGTTTTTACGGCTCAAGAAAAGAAAGTAAAAAAGTCTTTAGAAGATTTTAAAGAA---GCCTCAGGGATGTCTGATTTTATTCAGCAGATCATCCTGCCTTCCGAGAATGTT
TRN  11011101101011000
NAM  NUSG_HELPY/1-44
ASQ  MMDWYAIQTYSGSEQSVKKAIENLAN-DHNIRDRIQEIIVPTEDI
DSQ  ATGATGGATTGGTATGCCATACAAACTTATTCAGGGAGCGAGCAGTCCGTTAAGAAAGCGATTGAGAATCTAGCGAAC---GACCATAATATAAGAGATAGGATACAAGAGATCATTGTGCCTACTGAAGATATT
TRN  10010101110011001
NAM  NUSG_MYCTU/46-89
ASQ  PGDWYVVHSYAGYENKVKANLETRVQ-NLDVGDYIFQVEVPTEEV
DSQ  CCCGGCGACTGGTACGTCGTTCACTCCTACGCAGGGTACGAGAACAAGGTCAAGGCCAACCTGGAAACCCGGGTGCAG---AACCTTGATGTCGGCGACTACATCTTCCAGGTGGAGGTGCCCACCGAAGAGGTC
TRN  11011111101111111
NAM  NUSG_STRCO/110-153
ASQ  PGEWYVIHTYAGYENRVKTNLEQRAV-SLNVEDYIFQAEVPQEEV
DSQ  CCCGGCGAGTGGTACGTCATCCACACCTACGCCGGTTACGAGAACCGCGTGAAGACCAACCTCGAGCAGCGCGCCGTC---TCGCTCAACGTCGAGGACTACATCTTCCAGGCCGAGGTGCCGCAGGAAGAGGTC
TRN  11011111111111111
NAM  NUSG_STAAM/7-50
ASQ  AKRWYAVHTYSGYENKVKKNLEKRVE-SMNMTEQIFRVVIPEEEE
DSQ  GCAAAGCGTTGGTATGCAGTGCATACATATTCTGGATATGAAAATAAAGTTAAAAAGAATTTAGAAAAAAGAGTAGAA---TCTATGAATATGACTGAACAAATCTTTAGAGTAGTCATACCGGAAGAAGAAGAA
TRN  10010101110011010
NAM  NUSG_BACSU/2-45
ASQ  EKNWYVVHTYSGYENKVKANLEKRVE-SMGMQDKIFRVVVPEEEE
DSQ  GAAAAGAATTGGTATGTTGTTCACACGTACTCTGGTTATGAGAATAAAGTAAAAGCCAACTTGGAAAAGCGTGTTGAA---TCAATGGGGATGCAGGATAAAATTTTCCGTGTAGTCGTACCCGAAGAAGAAGAA
TRN  11111101111011001
NAM  NUSG_THETH/2-45
ASQ  SIEWYAVHTLVGQEEKAKANLEKRIK-AFGLQDKIFQVLIPTEEV
NAM  NUSG_THEMA/2-45
ASQ  KKKWYIVLTMSGYEEKVKENIEKKVE-ATGIKNLVGRIVIPEEVV
DSQ  AAGAAAAAGTGGTACATAGTCCTTACTATGTCCGGTTACGAGGAAAAGGTTAAAGAAAATATCGAAAAGAAAGTCGAA---GCCACCGGGATAAAAAATCTGGTGGGCCGTATTGTTATTCCTGAAGAGGTAGTT
TRN  10010101100011011
NAM  NUSG_SYNY3/20-63
ASQ  EGHWFAVQVASGCEKRVKLNLEQRIH-TLDVADRILQVEIPKTPI
DSQ  GAAGGCCATTGGTTTGCCGTACAGGTAGCCTCTGGCTGTGAAAAGCGGGTTAAGTTAAACCTTGAGCAGAGGATTCAC---ACCTTGGACGTGGCTGATCGCATCCTCCAGGTGGAAATTCCCAAAACTCCCATC
TRN  10010101110011010
NAM  NUSG_RICPR/17-60
ASQ  VKQWYVVHTASGAEKRIKEDILRKIA-KQKMTDFFEDILIPVFGV
DSQ  GTAAAACAGTGGTATGTAGTACATACTGCATCAGGAGCAGAGAAACGCATTAAAGAGGATATTCTTAGAAAAATCGCT---AAACAAAAGATGACAGATTTTTTTGAGGATATATTAATACCTGTTTTTGGAGTT
TRN  10010101110011000
NAM  NUSG_HAEIN/9-52
ASQ  KKRWYVLQAFSGFESRVALTLREYIK-QQQMEDQFGEVLVPTEEV
DSQ  AAAAAACGTTGGTATGTATTACAAGCGTTTTCTGGCTTTGAAAGTCGTGTAGCTCTAACTTTACGTGAATACATCAAA---CAACAACAAATGGAAGATCAATTTGGTGAAGTTTTAGTACCAACTGAAGAAGTA
TRN  11011101111011010
NAM  NUSG_ECOLI/5-48
ASQ  KKRWYVVQAFSGFEGRVATSLREHIK-LHNMEDLFGEVMVPTEEV
DSQ  AAAAAGCGCTGGTACGTCGTTCAGGCGTTTTCCGGTTTTGAAGGCCGCGTAGCAACGTCGCTGCGTGAGCATATCAAA---TTACACAACATGGAAGATTTGTTTGGTGAAGTCATGGTACCAACCGAAGAAGTG
TRN  11011101101011010
NAM  NUSG_TREPA/2-46
ASQ  AKEWYILHTFSGREARVERAVRMLVEHARIPTNVIFDIKIPEELL
DSQ  GCGAAAGAGTGGTATATTCTGCACACATTCTCGGGTCGCGAGGCAAGGGTGGAGCGGGCTGTCCGTATGCTCGTGGAGCATGCGAGGATTCCAACGAACGTTATCTTTGATATAAAAATCCCTGAGGAACTGCTT
TRN  10010101100011011
NAM  NUSG_BORBU/2-45
ASQ  SRAWYVVQTYSQYEKKIEQDIRLLIN-EGVFGGVVLDVKAPIEKV
DSQ  TCTAGAGCTTGGTATGTAGTTCAAACTTATTCTCAATATGAGAAAAAGATAGAGCAGGACATAAGGCTTTTAATAAAT---GAAGGTGTTTTTGGCGGTGTGGTATTAGATGTTAAGGCTCCTATTGAAAAAGTA
TRN  10010101110011010
//