EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02337 - Gag_p10)
FAM  PF02337
PID  Gag_p10
DES  Retroviral GAG p10 protein
IPR  IPR003322
ANO  5
ALN  93
AID  0.362441
APH  (O41288_9RETR/1-91:0.28849,GAG_SMRVH/1-93:0.37024,((GAG_IPHA/1-84:0.97418,GAG_MMTVB/1-92:0.67668):0.30412,GAG_JSRV/1-90:0.33514):0.46356);
ATP  (O41288_9RETR/1-91,GAG_SMRVH/1-93,((GAG_IPHA/1-84,GAG_MMTVB/1-92),GAG_JSRV/1-90));
ATL  3.41241
DNO  4
DLN  279
DID  0.481997
DPH  (O41288_9RETR/1-91:0.17687,GAG_SMRVH/1-93:0.45487,(GAG_MMTVB/1-92:0.64049,GAG_JSRV/1-90:0.38524):0.29067);
DTP  (O41288_9RETR/1-91,GAG_SMRVH/1-93,(GAG_MMTVB/1-92,GAG_JSRV/1-90));
DTL  1.94814
RID  0.420126
RPH  (O41288_9RETR/1-91:0.27665,GAG_SMRVH/1-93:0.38364,(GAG_MMTVB/1-92:0.92086,GAG_JSRV/1-90:0.43093):0.36531);
RTP  (O41288_9RETR/1-91,GAG_SMRVH/1-93,(GAG_MMTVB/1-92,GAG_JSRV/1-90));
RTL  2.37739
LNK  GAG_IPHA/1-84:P04023:
LNK  GAG_JSRV/1-90:P31622:M80216
LNK  GAG_MMTVB/1-92:P10258:M15122
LNK  GAG_SMRVH/1-93:P21411:M23385
LNK  O41288_9RETR/1-91:O41288:U85505
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O41288_9RETR/1-91
ASQ  MGQELSQHQI--YVGQLKEALKIRGVKVKGNDLFKFFDFVKDTCPWFPQEGTIDIKRWRRVGDCFQDYYNTFGPEKIPVTAFSYWNLIRDLID
DSQ  ATGGGACAAGAATTAAGTCAGCATCAGATC------TATGTAGGACAATTAAAAGAGGCTTTAAAGATACGAGGAGTAAAGGTTAAAGGTAATGATTTGTTTAAGTTTTTTGATTTTGTAAAAGACACTTGCCCTTGGTTCCCACAGGAAGGAACTATTGATATTAAAAGATGGCGTAGAGTAGGGGATTGTTTTCAGGACTATTATAATACTTTTGGGCCAGAAAAAATTCCTGTGACCGCCTTCTCTTATTGGAACCTCATTAGAGATTTAATAGAT
TRN  10010101110011010
NAM  GAG_SMRVH/1-93
ASQ  MGQASSHSENDLFISHLKESLKVRRIRVRKKDLVSFFSFIFKTCPWFPQEGSIDSRVWGRVGDCLNDYYRVFGPETIPITTFNYYNLIRDVLT
DSQ  ATGGGACAAGCATCTTCACACAGTGAAAATGATCTCTTTATAAGTCACTTAAAGGAATCTCTCAAGGTGCGTAGAATTCGGGTTCGCAAGAAAGACCTTGTCTCCTTTTTTAGTTTCATTTTTAAAACATGTCCATGGTTCCCCCAGGAAGGGTCTATTGACTCCCGTGTTTGGGGACGTGTTGGTGATTGTCTGAACGACTATTACCGTGTTTTTGGTCCTGAGACTATTCCGATCACCACTTTTAATTATTATAATTTAATAAGGGACGTCCTTACT
TRN  10010101100011000
NAM  GAG_JSRV/1-90
ASQ  MG---HTHSRQLFVHMLSVMLKHRGITVSKTKLINFLSFIEEVCPWFPREGTVNLETWKKVGEQIRTHYTLHGPEKVPVETLSFWTLIRDCLD
DSQ  ATGGGA---------CACACGCATAGTCGTCAGTTGTTTGTGCATATGTTATCTGTAATGTTAAAACATAGGGGGATCACTGTTTCTAAAACTAAATTAATTAATTTTCTTTCATTTATTGAGGAAGTTTGCCCTTGGTTTCCTAGGGAAGGCACAGTGAATTTGGAGACATGGAAGAAGGTGGGAGAGCAAATTCGGACGCATTATACCTTACACGGCCCTGAAAAGGTCCCTGTCGAGACATTATCTTTTTGGACATTGATTCGTGACTGCCTGGAT
TRN  10010101100011000
NAM  GAG_MMTVB/1-92
ASQ  MGVSGSKGQK-LFVSVLQRLLSERGLHVKESSAIEFYQFLIKVSPWFPEEGGLNLQDWKRVGREMKRYAAEHGTDSIPKQAYPIWLQLREILT
DSQ  ATGGGGGTCTCGGGATCAAAAGGGCAGAAA---CTCTTTGTTTCTGTTCTACAAAGACTCCTCTCAGAGAGGGGTCTTCATGTGAAAGAGAGCAGTGCAATAGAGTTTTATCAGTTCCTAATAAAGGTCTCTCCTTGGTTTCCCGAAGAAGGAGGATTAAATTTACAAGATTGGAAAAGGGTGGGAAGAGAGATGAAGAGGTACGCAGCAGAACATGGGACGGATAGTATACCAAAGCAGGCTTACCCCATTTGGCTTCAGTTGAGAGAGATACTGACA
TRN  10010101100011000
NAM  GAG_IPHA/1-84
ASQ  MG----SSQS--VVTALQTVLKQRDLKIAPRTLQNFMKEVDRVAPWYACSGSLTVASWNKLGKELDRKHAE-G--DLCLGTKAIWKLVKNCLE
//