EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02334 - RTP)
FAM  PF02334
PID  RTP
DES  Replication terminator protein
IPR  IPR003432
ANO  3
ALN  122
AID  0.980439
APH  (RTP_BACVA/1-122:0.00000,O85146_BACAM/1-122:0.01663,O85145_BACAT/1-122:0.02473);
ATP  (RTP_BACVA/1-122,O85146_BACAM/1-122,O85145_BACAT/1-122);
ATL  0.04136
DNO  3
DLN  366
DID  0.834244
DPH  (RTP_BACVA/1-122:0.10269,O85146_BACAM/1-122:0.10299,O85145_BACAT/1-122:0.09217);
DTP  (RTP_BACVA/1-122,O85146_BACAM/1-122,O85145_BACAT/1-122);
DTL  0.29785
RID  0.980439
RPH  (RTP_BACVA/1-122:0.00000,O85146_BACAM/1-122:0.01663,O85145_BACAT/1-122:0.02473);
RTP  (RTP_BACVA/1-122,O85146_BACAM/1-122,O85145_BACAT/1-122);
RTL  0.04136
LNK  O85145_BACAT/1-122:O85145:AF045056
LNK  O85146_BACAM/1-122:O85146:AF045057
LNK  RTP_BACVA/1-122:P68733:AF045054
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RTP_BACVA/1-122
ASQ  MKEEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRCKKLIEKALSDNF
DSQ  ATGAAAGAGGAAAAAAGGAGTTCAACGGGCTTTTTAGTAAAACAACGCGCGTTTTTAAAACTTTATATGATCACTATGACAGAGCAAGAAAGGCTATACGGCTTGAAGCTGCTTGAGGTGCTTCGATCTGAATTTAAAGAAATAGGTTTTAAGCCAAATCATACAGAAGTATACCGTTCTTTGCATGAGCTTCTTGATGATGGGATATTAAAGCAAATCAAAGTAAAAAAAGAAGGGGCTAAGCTTCAGGAAGTTGTCCTCTATCAATTTAAAGATTACGAAGCTGCCAAATTATATAAAAAACAGCTGAAGGTTGAGCTTGACCGCTGTAAAAAATTGATTGAAAAAGCGCTGTCAGATAATTTT
TRN  10010101100011000
NAM  O85146_BACAM/1-122
ASQ  MKEEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKPIGFKPNHTEVYRSLHELLDDGILKQVKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRCKKLIEKALSDNF
DSQ  TTGAAAGAAGAAAAAAGAAGTTCAACCGGTTTTTTAGTGAAACAAAGGGCTTTTTTAAAGCTTTACATGATTACGATGACAGAGCAGGAACGGCTTTACGGACTGAAGCTTCTTGAGGTGCTGCGCTCTGAATTTAAACCCATCGGTTTTAAGCCGAATCATACCGAGGTGTACCGTTCACTCCATGAACTTTTGGATGACGGGATTTTAAAGCAGGTAAAAGTCAAAAAAGAAGGAGCCAAACTCCAGGAAGTCGTTCTCTATCAGTTCAAAGACTACGAAGCTGCGAAGCTTTATAAAAAGCAGCTGAAGGTTGAGCTCGATCGCTGTAAAAAGCTGATTGAAAAAGCTCTCTCCGATAATTTT
TRN  10010101100011000
NAM  O85145_BACAT/1-122
ASQ  MKEEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKQIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKIELDRCKNLIEKALSDNF
DSQ  ATGAAAGAAGAAAAAAGAAGTTCTACCGGATTTTTAGTGAAACAACGCGCGTTTTTAAAACTCTACATGATTACAATGACAGAACAAGAAAGGCTGTATGGCCTGAAGTTGCTCGAAGTGCTGCGATCTGAGTTTAAACAGATTGGCTTTAAACCGAATCATACGGAAGTCTATCGGTCGCTCCATGAACTGCTTGATGACGGGATCTTAAAACAAATAAAAGTCAAAAAAGAAGGGGCCAAGCTGCAGGAGGTTGTTCTCTACCAGTTCAAAGATTATGAAGCAGCGAAACTATATAAAAAGCAGCTGAAAATCGAACTCGACCGCTGCAAAAACCTGATTGAAAAAGCACTGTCAGATAATTTT
TRN  10010101100011000
//