EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02315 - MDH)
FAM  PF02315
PID  MDH
DES  Methanol dehydrogenase beta subunit
IPR  IPR003420
ANO  4
ALN  95
AID  0.608643
APH  ((O24762_HYPME/6-100:0.34988,DHM2_METEX/1-93:0.21261):0.09001,DHM2_METME/1-91:0.25679,DHM2_PARDE/1-91:0.28897);
ATP  ((O24762_HYPME/6-100,DHM2_METEX/1-93),DHM2_METME/1-91,DHM2_PARDE/1-91);
ATL  1.19825
DNO  3
DLN  285
DID  0.680071
DPH  (O24762_HYPME/6-100:0.26843,DHM2_METEX/1-93:0.17181,DHM2_PARDE/1-91:0.20271);
DTP  (O24762_HYPME/6-100,DHM2_METEX/1-93,DHM2_PARDE/1-91);
DTL  0.64295
RID  0.60747
RPH  (O24762_HYPME/6-100:0.38346,DHM2_METEX/1-93:0.18664,DHM2_PARDE/1-91:0.33042);
RTP  (O24762_HYPME/6-100,DHM2_METEX/1-93,DHM2_PARDE/1-91);
RTL  0.90052
LNK  DHM2_METEX/1-93:P14775:X15792
LNK  DHM2_METME/1-91:P38540:
LNK  DHM2_PARDE/1-91:P29898:M57684
LNK  O24762_HYPME/6-100:O24762:AB004097
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O24762_HYPME/6-100
ASQ  LPIVAGAMLVAAGFVGMTTPAAMAYDGTKCKAPGNCWEPKPGFPEKIAGSKYDPKHNPKELAKQVESRKGEEARNAQRAAHFKKTGKWVYDVKKI
DSQ  CTCCCGATCGTCGCCGGAGCAATGCTCGTTGCCGCAGGGTTCGTTGGCATGACCACGCCTGCTGCAATGGCTTACGATGGCACCAAGTGCAAAGCACCCGGCAACTGCTGGGAGCCGAAGCCTGGCTTCCCGGAGAAAATCGCGGGCTCGAAGTACGACCCGAAGCATAACCCGAAGGAACTTGCAAAGCAGGTCGAGTCCCGCAAGGGCGAAGAAGCACGCAACGCTCAGCGCGCTGCTCACTTCAAGAAGACCGGCAAGTGGGTCTACGACGTCAAGAAGATC
TRN  11011101111011011
NAM  DHM2_METEX/1-93
ASQ  MKTTLIAAAIVALSG--LAAPALAYDGTKCKAAGNCWEPKPGFPEKIAGSKYDPKHDPKELNKQADSIKQMEERNKKRVENFKKTGKFEYDVAKI
DSQ  ATGAAGACCACTCTCATCGCCGCCGCCATCGTCGCCCTGTCCGGC------CTCGCCGCCCCGGCGCTCGCCTATGACGGCACCAAGTGCAAGGCCGCGGGCAATTGCTGGGAGCCGAAGCCCGGCTTCCCCGAGAAGATCGCCGGCTCCAAGTACGATCCCAAGCACGATCCCAAGGAGCTGAACAAGCAGGCCGATTCCATCAAGCAGATGGAAGAGCGCAACAAGAAGCGTGTCGAGAACTTCAAGAAGACCGGCAAGTTCGAATACGACGTCGCCAAGATC
TRN  11011111101111111
NAM  DHM2_PARDE/1-91
ASQ  MKRILTLTVAALALG----TPALAYDGTNCKAPGNCWEPKPDYPAKVEGSKYDPQHDPAELSKQGESLAVMDARNEWRVWNMKKTGKFEYDVKKI
DSQ  ATGAAACGCATCCTGACCCTGACCGTTGCCGCCCTGGCGCTCGGC------------ACTCCGGCGCTGGCCTATGACGGCACCAACTGCAAGGCCCCCGGCAATTGCTGGGAGCCGAAGCCCGACTACCCGGCAAAGGTCGAGGGCTCGAAATACGACCCGCAGCACGACCCGGCCGAACTGTCCAAGCAGGGCGAGTCGCTGGCCGTCATGGATGCCCGCAATGAATGGCGGGTCTGGAACATGAAAAAGACCGGCAAGTTCGAATATGACGTCAAGAAGATC
TRN  11011101101011011
NAM  DHM2_METME/1-91
ASQ  MKHVLTLLALASVFA--VSNQALAYDGQNCKEPGNCWENKPGYPEKIAGSKYDPKHDPVELNKQEESIKAMDARNAKRIANAKSSGNFVFDVK--
//