EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02294 - 7kD_DNA_binding)
FAM  PF02294
PID  7kD_DNA_binding
DES  7kD DNA-binding domain
IPR  IPR003212
ANO  2
ALN  62
AID  0.8
APH  (DN71_SULSO/1-62:0.16273,DN72_SULAC/1-61:0.08724);
ATP  (DN71_SULSO/1-62,DN72_SULAC/1-61);
ATL  0.24997
DNO  2
DLN  186
DID  0.775956
DPH  (DN71_SULSO/1-62:0.00209,DN72_SULAC/1-61:0.27027);
DTP  (DN71_SULSO/1-62,DN72_SULAC/1-61);
DTL  0.27236
RID  0.8
RPH  (DN71_SULSO/1-62:0.09644,DN72_SULAC/1-61:0.15353);
RTP  (DN71_SULSO/1-62,DN72_SULAC/1-61);
RTL  0.24997
LNK  DN71_SULSO/1-62:P61991:AE006798
LNK  DN72_SULAC/1-61:P13125:L08891
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  DN71_SULSO/1-62
ASQ  ATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK
DSQ  GCAACAGTAAAGTTCAAGTACAAAGGAGAAGAGAAGCAAGTAGATATAAGTAAGATAAAGAAGGTATGGAGAGTAGGCAAAATGATAAGCTTCACCTATGATGAGGGTGGAGGAAAGACTGGTAGAGGAGCTGTAAGCGAGAAAGACGCTCCAAAAGAACTACTACAAATGTTAGAGAAGCAAAAG
TRN  10010101110011010
NAM  DN72_SULAC/1-61
ASQ  AKVRFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNG-KTGRGAVSEKDAPKELMDMLARAE
DSQ  GCAAAAGTCAGGTTTAAGTATAAGGGTGAAGAGAAAGAAGTAGACACTTCAAAGATAAAGAAGGTCTGGAGAGTTGGCAAAATGGTGTCCTTTACCTATGACGACAATGGT---AAGACAGGTAGAGGAGCTGTAAGCGAAAAAGACGCTCCAAAAGAACTAATGGACATGTTAGCAAGAGCAGAA
TRN  10010101110011000
//