EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02267 - Rib_hydrolayse)
FAM  PF02267
PID  Rib_hydrolayse
DES  ADP-ribosyl cyclase
IPR  IPR003193
ANO  5
ALN  249
AID  0.436823
APH  (NADA_APLKU/28-272:0.82528,(CD38_RAT/58-299:0.23817,CD38_HUMAN/56-296:0.29863):0.45370,(BST1_HUMAN/40-280:0.08545,BST1_MOUSE/35-273:0.14384):0.41568);
ATP  (NADA_APLKU/28-272,(CD38_RAT/58-299,CD38_HUMAN/56-296),(BST1_HUMAN/40-280,BST1_MOUSE/35-273));
ATL  2.46075
DNO  5
DLN  747
DID  0.529584
DPH  ((NADA_APLKU/28-272:0.60011,(BST1_HUMAN/40-280:0.05884,BST1_MOUSE/35-273:0.14461):0.32885):0.36323,CD38_RAT/58-299:0.17707,CD38_HUMAN/56-296:0.15151);
DTP  ((NADA_APLKU/28-272,(BST1_HUMAN/40-280,BST1_MOUSE/35-273)),CD38_RAT/58-299,CD38_HUMAN/56-296);
DTL  1.82422
RID  0.436823
RPH  (NADA_APLKU/28-272:0.82528,(CD38_RAT/58-299:0.23817,CD38_HUMAN/56-296:0.29863):0.45370,(BST1_HUMAN/40-280:0.08545,BST1_MOUSE/35-273:0.14384):0.41568);
RTP  (NADA_APLKU/28-272,(CD38_RAT/58-299,CD38_HUMAN/56-296),(BST1_HUMAN/40-280,BST1_MOUSE/35-273));
RTL  2.46075
LNK  BST1_HUMAN/40-280:Q10588:D21878
LNK  BST1_MOUSE/35-273:Q64277:L32812
LNK  CD38_HUMAN/56-296:P28907:M34461
LNK  CD38_RAT/58-299:Q64244:D30795
LNK  NADA_APLKU/28-272:Q27312:D30048
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  NADA_APLKU/28-272
ASQ  TPELQNVFLGRCKDYEITRYLTIL-PR-VKSDCRALWTNFFKAFSFKAPCNLDLGSYKDFFQRAQQTLPKNKVMFWSGVYDEAHDFADDGRKYITLEDTLPGYMLNSLVWCGQRDKPGFNQKVCP-DFKDCPVQARESFWGTASSSYAHSAEGDVTYMVDGSNPKVPAYRPDSFFGKYELPNLT-NKVTKVKVIVLHQLGQKIIERCGAGSLLDLEMVVKAKKFGFDCVENPKSVLFLLCADNPNAREC
DSQ  ACTCCCGAGTTGCAGAATGTGTTCCTTGGGCGCTGTAAGGATTATGAGATCACCAGATACCTGACCATTCTT---CCCAGA---GTGAAATCGGATTGCAGGGCATTGTGGACCAACTTTTTCAAAGCATTCTCCTTTAAAGCTCCCTGTAACCTCGACCTTGGAAGTTACAAGGATTTTTTCCAGAGAGCGCAACAGACGCTGCCAAAGAACAAAGTGATGTTCTGGTCCGGAGTCTATGACGAAGCTCATGATTTCGCGGACGACGGCCGGAAGTACATCACTTTGGAAGATACACTTCCGGGTTACATGTTGAACTCTCTGGTTTGGTGCGGCCAACGCGATAAACCAGGGTTCAACCAAAAAGTGTGTCCG---GACTTTAAAGACTGTCCAGTGCAAGCTAGAGAGAGCTTCTGGGGAACCGCGTCAAGCTCGTATGCCCACAGTGCAGAGGGAGATGTGACCTACATGGTCGACGGTTCGAATCCCAAGGTACCGGCTTATAGGCCAGACAGTTTTTTTGGCAAGTACGAACTGCCCAATCTGACT---AACAAGGTGACAAAGGTGAAGGTCATTGTCCTGCACCAGCTTGGGCAAAAGATCATCGAGAGGTGCGGTGCAGGATCTTTGCTGGACCTAGAGATGGTTGTCAAAGCCAAGAAATTTGGGTTCGACTGCGTGGAAAATCCAAAGTCTGTTCTCTTCTTGCTGTGCGCCGACAACCCCAATGCCAGAGAGTGT
TRN  10010101100011001
NAM  CD38_HUMAN/56-296
ASQ  TKRFPETVLARC-----VKYTEIH-PEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLNGSRSK--IFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSC
DSQ  ACCAAGCGCTTTCCCGAGACCGTCCTGGCGCGATGC---------------GTCAAGTACACTGAAATTCAT---CCTGAGATGAGACATGTAGACTGCCAAAGTGTATGGGATGCTTTCAAGGGTGCATTTATTTCAAAACATCCTTGCAACATTACTGAAGAAGACTATCAGCCACTAATGAAGTTGGGAACTCAGACCGTACCTTGCAACAAGATTCTTCTTTGGAGCAGAATAAAAGATCTGGCCCATCAGTTCACACAGGTCCAGCGGGACATGTTCACCCTGGAGGACACGCTGCTAGGCTACCTTGCTGATGACCTCACATGGTGTGGTGAATTCAACACTTCCAAAATAAACTATCAATCTTGCCCAGACTGGAGAAAGGACTGCAGCAACAACCCTGTTTCAGTATTCTGGAAAACGGTTTCCCGCAGGTTTGCAGAAGCTGCCTGTGATGTGGTCCATGTGATGCTCAATGGATCCCGCAGTAAA------ATCTTTGACAAAAACAGCACTTTTGGGAGTGTGGAAGTCCATAATTTGCAACCAGAGAAGGTTCAGACACTAGAGGCCTGGGTGATACATGGTGGAAGAGAAGATTCCAGAGACTTATGCCAGGATCCCACCATAAAAGAGCTGGAATCGATTATAAGCAAAAGGAATATTCAATTTTCCTGCAAGAATATCTACAGACCTGACAAGTTTCTTCAGTGTGTGAAAAATCCTGAGGATTCATCTTGC
TRN  10010101100011000
NAM  CD38_RAT/58-299
ASQ  TKHFADIILGRC-----LIYTQILRPEMRDQDCKKILSTFKRGFISKNPCNITNEDYAPLVKLVTQTIPCNKTLFWSKSKHLAHQYTWIQGKMFTLEDTLLGYIADDLRWCGDPSTSDMNYDSCPHWSENCPNNPVAVFWNVISQKFAEDACGVVQVMLNGSLSE--PFYRNSTFGSVEVFNLDPNKVHKLQAWVMHDIKGTSSNACSSPSINELKSIVNKRNMIFACQDNYRPVRFLQCVKNPEHPSC
DSQ  ACGAAGCACTTCGCTGACATCATCTTGGGACGCTGC---------------CTGATCTATACTCAAATCCTCCGGCCGGAGATGAGAGATCAGGACTGCAAGAAGATACTAAGTACATTCAAAAGAGGGTTTATTTCCAAGAATCCTTGCAACATCACCAATGAAGACTACGCACCACTGGTTAAATTGGTTACTCAAACCATACCATGTAACAAGACTCTCTTTTGGAGCAAGTCCAAACACCTGGCCCATCAGTATACTTGGATCCAGGGGAAAATGTTCACCCTGGAGGACACACTGCTGGGCTATATTGCAGATGATCTCAGGTGGTGTGGAGACCCCAGTACTTCCGATATGAACTATGACTCTTGCCCACATTGGAGTGAAAATTGTCCCAACAACCCTGTTGCTGTGTTCTGGAATGTGATTTCCCAAAAGTTTGCAGAAGATGCCTGTGGTGTGGTCCAAGTGATGCTCAATGGGTCCCTCAGTGAG------CCATTTTACAGAAACAGCACCTTTGGAAGTGTGGAAGTCTTTAATTTGGACCCAAATAAGGTTCATAAACTACAGGCCTGGGTAATGCATGACATTAAAGGAACTTCCAGTAATGCATGTTCGAGCCCCTCCATAAATGAGCTGAAGTCGATTGTGAACAAAAGGAATATGATATTTGCCTGCCAGGATAACTACCGACCTGTAAGATTTCTTCAGTGTGTGAAGAATCCTGAGCATCCATCATGT
TRN  10010101100011001
NAM  BST1_MOUSE/35-273
ASQ  TPHLQSIFLGRC-----AEYTTLLSL--GNKNCTAIWEAFK-GVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCP-TSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKG-AYPTRGFFADFEIPYLQKDKVTRIEIWVMHDVGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDC
DSQ  ACTCCTCACCTCCAGAGCATCTTCCTGGGCCGCTGC---------------GCAGAGTACACCACGCTGCTGAGCCTG------GGGAACAAAAACTGCACAGCCATCTGGGAGGCCTTCAAG---GGGGTGCTGGACAAGGACCCCTGCTCTGTGCTCCCCTCAGACTATGATCTCTTCATTAACCTCTCCAGGCACCCCATTCCTAGGGACAAGTCACTGTTCTGGGAGAATAACCACCTGCTCGTTATGAGCTATGGGGAGAACACCCGCCGCCTCGTGGCCCTGTGCGACGTGCTGTATGGCAAAGTTGGCGATTTCTTGAGCTGGTGTCGACAGGAAAATGCCTCTGGACTTGACTACCAGTCCTGCCCC---ACATCAGAAGACTGTGAAAACAACGCCGTGGACTCCTATTGGAAAAGTGCATCGATGCAGTATTCAAGAGACAGTTCAGGGGTGATCAACGTCATGCTGAATGGCTCGGAGCCAAAAGGA---GCCTATCCCACGAGAGGGTTTTTTGCAGATTTTGAAATCCCGTACTTACAAAAGGATAAAGTCACAAGAATAGAGATCTGGGTTATGCATGACGTTGGAGGGCCCAATGTGGAATCCTGTGGCGAAGGTAGTGTGAAAATCCTGGAAGACAGATTGGAGGCCCTGGGGTTCCAGCACAGCTGTATCAATGACTACCGACCAGTGAAGTTCTTAATGTGTGTGGACCACAGCACTCACCCCGACTGT
TRN  10010101100011000
NAM  BST1_HUMAN/40-280
ASQ  SAHLRDIFLGRC-----AEYRALLSPEQRNKNCTAIWEAFK-VALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCP-TSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTG-AYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDC
DSQ  AGCGCACACTTGCGGGACATCTTCCTGGGCCGCTGC---------------GCCGAGTACCGCGCACTGCTGAGTCCCGAGCAGCGGAACAAGAACTGCACAGCCATCTGGGAAGCCTTTAAA---GTGGCGCTGGACAAGGATCCCTGCTCCGTGCTGCCCTCAGACTATGACCTTTTTATTAACTTGTCCAGGCACTCTATTCCCAGAGATAAGTCCCTGTTCTGGGAAAATAGCCACCTCCTTGTTAACAGCTTTGCAGACAACACCCGTCGTTTTATGCCCCTGAGCGATGTTCTGTATGGCAGGGTTGCAGATTTCTTGAGCTGGTGTCGACAGAAAAATGACTCTGGACTCGATTACCAATCCTGCCCT---ACATCAGAAGACTGTGAAAATAATCCTGTGGATTCCTTTTGGAAAAGGGCATCCATCCAGTATTCCAAGGATAGTTCTGGGGTGATCCACGTCATGCTGAATGGTTCAGAGCCAACAGGA---GCCTATCCCATCAAAGGTTTTTTTGCAGATTATGAAATTCCAAACCTCCAGAAGGAAAAAATTACACGAATCGAGATCTGGGTTATGCATGAAATTGGGGGACCCAATGTGGAATCCTGCGGGGAAGGCAGCATGAAAGTCCTGGAAAAGAGGCTGAAGGACATGGGGTTCCAGTACAGCTGTATTAATGATTACCGACCAGTGAAGCTCTTACAGTGCGTGGACCACAGCACCCATCCTGACTGT
TRN  10010101100011000
//