EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02247 - Como_LCP)
FAM  PF02247
PID  Como_LCP
DES  Large coat protein
IPR  IPR003181
ANO  10
ALN  381
AID  0.45343
APH  (((((VGNM_CPMV/460-832:0.00000,Q66170_CPMV/343-715:0.00000):0.34585,VGNM_RCMV/407-778:0.32597):0.12386,(VGNM_CPSMV/437-806:0.39838,VGNM_BPMV/447-819:0.23659):0.05909):0.21951,(Q9YWK0_9COMO/363-735:0.01455,(Q9YWJ9_9COMO/452-824:0.00266,VGNM_SQMVM/233-605:0.00540):0.01804):0.15413):2.19957,O12663_9COMO/321-691:0.00000,Q9Z006_9COMO/476-846:0.13623);
ATP  (((((VGNM_CPMV/460-832,Q66170_CPMV/343-715),VGNM_RCMV/407-778),(VGNM_CPSMV/437-806,VGNM_BPMV/447-819)),(Q9YWK0_9COMO/363-735,(Q9YWJ9_9COMO/452-824,VGNM_SQMVM/233-605))),O12663_9COMO/321-691,Q9Z006_9COMO/476-846);
ATL  4.21667
DNO  8
DLN  1143
DID  0.505413
DPH  (((VGNM_CPMV/460-832:0.00000,Q66170_CPMV/343-715:0.00000):0.33342,((O12663_9COMO/321-691:0.05478,Q9Z006_9COMO/476-846:0.18099):1.39210,(Q9YWK0_9COMO/363-735:0.06095,Q9YWJ9_9COMO/452-824:0.05935):0.14849):0.14916):0.07763,VGNM_BPMV/447-819:0.27678,VGNM_RCMV/407-778:0.34930);
DTP  (((VGNM_CPMV/460-832,Q66170_CPMV/343-715),((O12663_9COMO/321-691,Q9Z006_9COMO/476-846),(Q9YWK0_9COMO/363-735,Q9YWJ9_9COMO/452-824))),VGNM_BPMV/447-819,VGNM_RCMV/407-778);
DTL  3.08295
RID  0.426777
RPH  (((((VGNM_CPMV/460-832:0.00000,Q66170_CPMV/343-715:0.00000):0.36254,VGNM_RCMV/407-778:0.31101):0.11524,VGNM_BPMV/447-819:0.24580):0.27885,(Q9YWK0_9COMO/363-735:0.01678,Q9YWJ9_9COMO/452-824:0.01849):0.11397):2.22077,O12663_9COMO/321-691:0.00000,Q9Z006_9COMO/476-846:0.13608);
RTP  (((((VGNM_CPMV/460-832,Q66170_CPMV/343-715),VGNM_RCMV/407-778),VGNM_BPMV/447-819),(Q9YWK0_9COMO/363-735,Q9YWJ9_9COMO/452-824)),O12663_9COMO/321-691,Q9Z006_9COMO/476-846);
RTL  3.81955
LNK  O12663_9COMO/321-691:O12663:U65985
LNK  Q66170_CPMV/343-715:Q66170:X00729
LNK  Q9YWJ9_9COMO/452-824:Q9YWJ9:AF059533
LNK  Q9YWK0_9COMO/363-735:Q9YWK0:AF059532
LNK  Q9Z006_9COMO/476-846:Q9Z006:AB011007
LNK  VGNM_BPMV/447-819:P23009:M62738
LNK  VGNM_CPMV/460-832:P03599:X00729
LNK  VGNM_CPSMV/437-806:P31630:
LNK  VGNM_RCMV/407-778:P13561:M14913
LNK  VGNM_SQMVM/233-605:P36341:
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VGNM_SQMVM/233-605
ASQ  NELDLAQLSLDDTSSLRGTALQTKLATSRIILSKTMVGNTVLREDLLATFLQDSNERAAIDLIRTHVIRGKIRCVASINVPENTGCALAICFNSGITGA-ADTDIYTTSSQNAIVWNPACEKAVELTFNPNPCGDAWNFVFLQQTKAH--FAVQCVTGWTTTPLTDLALVLTWHIDRSLCVPKTLTISSAHASFPINRWMGKLSFPQGPARVLKRMPLAIGGGAGTKDAILMNMPNAVISLHRYFRGDFVFEITKMSSPYIKATIAFFIAFGDITEEMTN---LESFPHKLVQFREIQGRT-TITFTQSEFLTAWSTQVLSTVNPQKDGCPHLYALLH-DSATSTIEGNFVIGVKLLDIRNYRAYGHNPGFEGARLLGISG
NAM  Q9YWJ9_9COMO/452-824
ASQ  NELDLAQLSLDDTSSLRGTALQTKLATSRIILSKTMVGNTVLREDLLATFLQDSNERAAIDLIRTHVIRGKIRCVASINVPENTGCALAICFNSGITGA-ADTDIYTTSSQDAIVWNPACEKAVELTFNPNPCGDAWNFVFLQQTKAH--FAVQCVTGWTTTPLTDLALVLTWHIDRSLCVPKTLTISSAHASFPINRWMGKLSFPQGPARVLKRMPLAIGGGAGTKDAILMNMPNAVISLHRYFRGDFVFEITKMSSPYIKATIAFFIAFGDITEEMTN---LESFPHKLVQFAEIQGRT-TITFTQSEFLTAWSTQVLSTVDPQKDGCPHLYALLH-DSATSTIEGNFVIGVKLLDIRNYRAYGHNPGFEGARLLGISG
DSQ  AATGAGCTAGATCTTGCGCAACTTTCTCTGGACGACACCAGTTCTCTTCGTGGAACTGCGTTGCAGACCAAACTGGCCACGTCCCGTATCATTTTGAGTAAGACAATGGTTGGAAATACTGTGCTCAGGGAGGATTTGCTTGCCACCTTTTTGCAAGATAGCAATGAGAGGGCCGCTATAGATTTGATTCGCACCCATGTCATTAGAGGCAAAATACGCTGTGTTGCTTCTATCAATGTTCCAGAAAATACAGGTTGTGCATTAGCTATCTGTTTCAACAGTGGCATAACAGGAGCT---GCAGATACAGACATTTATACCACAAGTTCTCAGGATGCCATTGTGTGGAATCCTGCTTGCGAGAAAGCTGTTGAGTTGACATTCAACCCCAATCCTTGTGGTGATGCTTGGAATTTTGTGTTTCTGCAACAAACAAAGGCACAT------TTTGCCGTTCAGTGTGTGACCGGGTGGACTACAACGCCACTTACAGATTTAGCGTTGGTGCTTACATGGCACATTGATAGAAGCTTGTGTGTGCCCAAAACTTTGACAATTAGCTCTGCACATGCTTCTTTTCCAATAAATCGTTGGATGGGAAAGTTGTCCTTTCCGCAAGGGCCTGCGCGTGTTCTTAAGAGGATGCCCTTGGCCATTGGTGGCGGGGCTGGTACCAAAGATGCTATCTTGATGAATATGCCAAACGCTGTTATTTCACTTCATCGATATTTTAGAGGGGATTTTGTCTTTGAAATAACAAAGATGAGTTCTCCTTATATCAAGGCAACCATTGCTTTCTTTATAGCGTTTGGTGATATTACGGAGGAAATGACTAAC---------TTGGAGAGTTTTCCCCACAAGCTTGTGCAGTTTGCTGAAATTCAGGGGCGCACT---ACCATAACGTTCACGCAAAGCGAATTTTTGACGGCATGGTCTACACAAGTATTAAGCACTGTTGATCCTCAGAAAGATGGGTGTCCCCACTTGTATGCACTCTTGCAC---GATTCTGCTACGTCAACCATTGAAGGAAATTTTGTCATTGGTGTTAAATTGCTGGATATTAGGAACTATCGTGCTTACGGCCATAACCCTGGTTTTGAGGGAGCTCGCTTACTAGGAATTTCTGGG
TRN  10010101100011000
NAM  Q9YWK0_9COMO/363-735
ASQ  NELDLAQLSLDDTSSLRGSVLQTKLATSRVILSKTMVGNTILRENLLATFLQDSNERAAIDLIRTHVIRGKIRCVASINVPENTGCALAICFNSGITGA-ADTDIYTTSSQDAIVWNPACEKAVELSFNPNPCSDAWNFVFLQKTKAH--FAVQCVTGWTTTPLTDLALVLTWHIDRNLCVPETLTISSAHASFPINRWMGKLSFPQGPARVLKRMPLAIGGGAGTKDAILMNMPNAVISLHRYFRGDFVFEITKMSSPYIKATIAFFIAFGDITEEMTN---LESFPHKLVQFAEIQGRT-TITFTQGEFLTAWSTQVLSTVNPQKDGCPHLYALLH-DSATSTIEGNFIIGVKLLDIRNYRAYGHNPGFEGARLLGISG
DSQ  AATGAACTAGATCTTGCGCAACTTTCCTTGGATGATACTAGTTCTCTTCGTGGATCTGTGTTGCAAACCAAATTAGCCACATCCCGTGTCATTTTAAGTAAAACAATGGTCGGGAATACTATCCTCAGGGAAAATTTGCTCGCCACCTTCTTGCAGGATAGCAATGAGAGGGCCGCGATAGATTTAATTCGCACCCATGTTATAAGAGGCAAAATACGCTGTGTTGCTTCTATCAATGTTCCAGAGAATACAGGTTGTGCTTTGGCTATTTGCTTCAATAGTGGCATAACAGGAGCT---GCTGACACGGACATATACACCACGAGTTCTCAGGACGCTATAGTGTGGAATCCTGCTTGTGAGAAGGCTGTTGAGTTGTCATTTAACCCCAATCCCTGCAGTGATGCCTGGAACTTTGTGTTTTTGCAGAAGACAAAGGCACAT------TTTGCAGTTCAGTGTGTGACTGGATGGACTACAACGCCACTTACAGACTTGGCTCTAGTGCTCACATGGCATATCGATAGAAACTTGTGCGTGCCTGAAACTTTGACGATTAGTTCTGCACACGCTTCTTTCCCAATCAATCGCTGGATGGGAAAGTTATCTTTCCCACAAGGACCTGCACGTGTTCTAAAAAGGATGCCCTTGGCCATCGGTGGTGGAGCCGGCACCAAAGATGCTATTCTAATGAATATGCCAAATGCTGTTATTTCACTACATCGTTATTTTAGAGGGGATTTCGTCTTTGAAATAACAAAGATGAGTTCTCCTTATATAAAGGCAACCATTGCTTTCTTTATAGCATTTGGTGATATCACAGAGGAAATGACCAAT---------TTGGAGAGTTTTCCCCACAAGCTTGTGCAGTTTGCTGAAATTCAGGGGCGCACC---ACCATAACATTTACGCAAGGCGAATTTTTGACGGCATGGTCAACACAAGTTTTAAGCACCGTTAATCCTCAGAAAGATGGATGTCCCCATTTGTATGCACTCTTGCAT---GACTCTGCTACGTCAACCATTGAAGGAAATTTCATTATTGGTGTTAAACTGCTGGACATTAGGAACTATCGTGCTTATGGCCATAACCCCGGTTTTGAGGGAGCCCGCCTGTTAGGAATTTCTGGG
TRN  10010101100011000
NAM  VGNM_RCMV/407-778
ASQ  TDTDLFKLSLDDTSSPKGSLLDTRFAQKKVLIPKAMAGGADLLSSNLYDVLSGSSFRASLALARTHVVEGKIRCICTINLPENTGCCLAITVNSSNRGQ-FSTDIYTTGSQDRILWNPACSKNCDFSFNPNPCGTAWSLEFLRRTKFH--LSVTCVSGWSAQPQTDIAMTMDWYVSNKPCVPCIYNVGTPGQNVWVNRWMGKLSFPQGSQNQLKQMPLAIGGGAGAKNSILMNMTNAFLSLWRYFHGDLVFEVQKMSSPFIKSTVTFFIGFGGLPFSEN----LEDFPNKLIQFGEVQERV-EITFTRKEFLTAWSTQVDPAGPVAGDGCPYLCAMVH-DSTASTITGDFNLGVTLLRIENFVGIGRNPGIQGARLLGSMQ
DSQ  ACTGACACTGATTTGTTCAAATTAAGTTTGGATGATACGTCGAGTCCCAAAGGATCACTATTAGACACAAGATTTGCCCAAAAGAAAGTTTTGATTCCAAAAGCAATGGCAGGGGGGGCAGACTTACTGAGTTCAAATCTTTATGATGTGCTATCGGGAAGTTCCTTTAGAGCCTCTCTAGCATTAGCAAGAACTCATGTGGTTGAAGGAAAGATCAGGTGTATTTGCACCATAAACTTACCTGAGAATACTGGGTGCTGTCTGGCAATCACAGTTAATAGCAGCAATAGAGGGCAG---TTTAGTACAGATATATATACAACAGGTTCTCAGGACAGAATTTTATGGAATCCTGCTTGTTCCAAAAATTGTGATTTCTCCTTTAATCCAAATCCTTGTGGGACTGCATGGAGCTTGGAATTCTTGCGTCGCACTAAGTTTCAC------TTGAGTGTCACATGTGTGTCGGGGTGGTCAGCCCAACCGCAGACAGACATTGCCATGACAATGGATTGGTATGTGAGTAATAAGCCATGTGTGCCATGTATTTACAATGTTGGAACGCCTGGACAAAATGTTTGGGTTAATAGATGGATGGGTAAACTGTCTTTCCCTCAAGGATCTCAAAATCAACTTAAACAGATGCCCTTGGCCATAGGTGGCGGTGCTGGAGCAAAAAATAGTATTCTTATGAATATGACCAATGCTTTTCTGAGTCTCTGGCGCTACTTTCACGGTGATCTAGTTTTTGAGGTACAGAAAATGAGTTCTCCTTTTATAAAGTCAACTGTGACTTTCTTCATAGGTTTTGGGGGTCTTCCTTTTAGTGAAAAC------------TTGGAAGATTTTCCAAATAAGCTGATTCAATTTGGAGAAGTGCAAGAAAGAGTG---GAGATAACATTTACTAGGAAGGAATTCCTGACGGCGTGGTCTACCCAAGTTGACCCAGCTGGACCTGTGGCTGGTGATGGTTGCCCTTATTTGTGTGCTATGGTACAT---GATTCAACAGCCAGTACCATAACAGGAGATTTTAACTTGGGTGTCACCCTATTGCGCATTGAGAATTTTGTGGGCATAGGCAGAAATCCTGGAATACAGGGGGCCCGATTGCTAGGAAGCATGCAA
TRN  10010101100011000
NAM  VGNM_BPMV/447-819
ASQ  METNLFKLSLDDVETPKGSMLDLKISQSKIALPKNTVGGTILRSDLLANFLTEGNFRASVDLQRTHRIKGMIKMVATVGIPENTGIALACAMNSSIRGR-ASSDIYTICSQDCELWNPACTKAMTMSFNPNPCSDAWSLEFLKRTGFH--CDIICVTGWTATPMQDVQVTIDWFISSQECVPRTYCVLNPQNPFVLNRWMGKLTFPQGTSRSVKRMPLSIGGGAGAKSAILMNMPNAVLSMWRYFVGDLVFEVSKMTSPYIKCTVSFFIAFGNLADDTIN---FEAFPHKLVQFGEIQEKV-VLKFSQEEFLTAWSTQVRPATTLLADGCPYLYAMVH-DSSVSTIPGDFVIGVKLTIIENMCAYGLNPGISGSRLLGTIP
DSQ  ATGGAAACAAATCTATTCAAATTGTCTCTTGATGATGTTGAGACTCCAAAAGGTTCCATGTTAGACCTCAAGATTTCCCAATCTAAGATTGCACTTCCCAAAAATACAGTTGGAGGGACCATTTTGCGCAGTGATCTGCTGGCAAATTTCTTGACAGAAGGCAATTTTAGAGCAAGTGTTGATTTGCAACGTACCCACCGTATCAAAGGAATGATTAAAATGGTGGCTACAGTTGGCATTCCTGAAAACACAGGTATAGCGCTGGCTTGTGCAATGAATAGTTCCATTAGAGGGCGT---GCCAGTTCTGATATCTATACTATTTGTTCGCAAGATTGTGAACTATGGAATCCTGCTTGTACAAAAGCAATGACTATGTCATTTAATCCAAACCCATGTTCTGATGCGTGGAGTTTGGAATTTCTTAAACGTACTGGATTCCAC------TGTGATATTATTTGTGTTACTGGATGGACTGCAACTCCAATGCAAGATGTTCAAGTTACAATTGATTGGTTCATTTCCTCTCAAGAGTGCGTTCCCAGAACCTACTGTGTTTTGAATCCACAAAATCCTTTTGTGTTGAATAGATGGATGGGAAAGTTGACTTTTCCTCAAGGCACTTCTCGGAGTGTTAAAAGGATGCCTCTCTCTATAGGAGGAGGAGCTGGTGCTAAAAGTGCTATTCTCATGAATATGCCAAATGCAGTTCTTTCAATGTGGAGGTACTTTGTAGGAGATCTTGTTTTTGAAGTTTCAAAGATGACCTCTCCTTACATTAAATGTACAGTATCTTTTTTCATAGCATTTGGAAATTTGGCTGATGATACCATCAAT---------TTTGAAGCTTTTCCTCACAAATTGGTGCAGTTTGGAGAAATTCAGGAAAAAGTT---GTGCTGAAATTTTCACAAGAGGAGTTTCTCACAGCATGGTCCACTCAGGTGCGTCCTGCAACAACCTTGCTGGCTGATGGGTGCCCATATTTGTATGCTATGGTGCAT---GATAGTTCAGTGTCCACAATACCAGGTGATTTTGTTATTGGTGTCAAGTTGACGATCATAGAAAATATGTGCGCATATGGACTTAATCCTGGTATTTCAGGCTCCCGTCTTCTTGGCACCATTCCT
TRN  10010101100011000
NAM  Q66170_CPMV/343-715
ASQ  MEQNLFALSLDDTSSVRGSLLDTKFAQTRVLLSKAMAGGDVLLDEYLYDVVNGQDFRATVAFLRTHVITGKIKVTATTNISDNSGCCLMLAINSGVRGK-YSTDVYTICSQDSMTWNPGCKKNFSFTFNPNPCGDSWSAEMISRSRVR--MTVICVSGWTLSPTTDVIAKLDWSIVNEKCEPTIYHLADCQNWLPLNRWMGKLTFPQGVTSEVRRMPLSIGGGAGATQAFLANMPNSWISMWRYFRGELHFEVTKMSSPYIKATVTFLIAFGNLSDAFGF---YESFPHRIVQFAEVEEKC-TLVFSQQEFVTAWSTQVNPRTTLEADGCPYLYAIIH-DSTTGTISGDFNLGVKLVGIKDFCGIGSNPGIDGSRLLGAIA
DSQ  ATGGAGCAAAACTTGTTTGCCCTTTCTTTGGATGATACAAGCTCAGTTCGTGGTTCTTTGCTTGACACAAAATTCGCACAAACTCGAGTTTTGTTGTCCAAGGCTATGGCTGGTGGTGATGTGTTATTGGATGAGTATCTCTATGATGTGGTCAATGGACAAGATTTTAGAGCTACTGTCGCTTTTTTGCGCACCCATGTTATAACAGGCAAAATAAAGGTGACAGCTACCACCAACATTTCTGACAACTCGGGTTGTTGTTTGATGTTGGCCATAAATAGTGGTGTGAGGGGTAAG---TATAGTACTGATGTTTATACTATCTGCTCTCAAGACTCCATGACGTGGAACCCAGGGTGCAAAAAGAACTTCTCGTTCACATTTAATCCAAACCCTTGTGGGGATTCTTGGTCTGCTGAGATGATAAGTCGAAGCAGAGTTAGG------ATGACAGTTATTTGTGTTTCGGGATGGACCTTATCTCCTACCACAGATGTGATTGCCAAGCTAGACTGGTCAATTGTCAATGAGAAATGTGAGCCCACCATTTACCACTTGGCTGATTGTCAGAATTGGTTACCCCTTAATCGTTGGATGGGAAAATTGACTTTTCCCCAGGGTGTGACAAGTGAGGTTCGAAGGATGCCTCTTTCTATAGGAGGCGGTGCTGGTGCGACTCAAGCTTTCTTGGCCAATATGCCCAATTCATGGATATCAATGTGGAGATATTTTAGAGGTGAACTTCACTTTGAAGTTACTAAAATGAGCTCTCCATATATTAAAGCCACTGTTACATTTCTCATAGCTTTTGGTAATCTTAGTGATGCCTTTGGTTTT---------TATGAGAGTTTTCCTCATAGAATTGTTCAATTTGCTGAGGTTGAGGAAAAATGT---ACTTTGGTTTTCTCCCAACAAGAGTTTGTCACTGCTTGGTCAACACAAGTAAACCCCAGAACCACACTTGAAGCAGATGGTTGTCCCTACCTATATGCAATTATTCAT---GATAGTACAACAGGTACAATCTCCGGAGATTTTAATCTTGGGGTCAAGCTTGTTGGCATTAAGGATTTTTGTGGTATAGGTTCTAATCCGGGTATTGATGGTTCCCGCTTGCTTGGAGCTATAGCA
TRN  10010101110011000
NAM  VGNM_CPMV/460-832
ASQ  MEQNLFALSLDDTSSVRGSLLDTKFAQTRVLLSKAMAGGDVLLDEYLYDVVNGQDFRATVAFLRTHVITGKIKVTATTNISDNSGCCLMLAINSGVRGK-YSTDVYTICSQDSMTWNPGCKKNFSFTFNPNPCGDSWSAEMISRSRVR--MTVICVSGWTLSPTTDVIAKLDWSIVNEKCEPTIYHLADCQNWLPLNRWMGKLTFPQGVTSEVRRMPLSIGGGAGATQAFLANMPNSWISMWRYFRGELHFEVTKMSSPYIKATVTFLIAFGNLSDAFGF---YESFPHRIVQFAEVEEKC-TLVFSQQEFVTAWSTQVNPRTTLEADGCPYLYAIIH-DSTTGTISGDFNLGVKLVGIKDFCGIGSNPGIDGSRLLGAIA
DSQ  ATGGAGCAAAACTTGTTTGCCCTTTCTTTGGATGATACAAGCTCAGTTCGTGGTTCTTTGCTTGACACAAAATTCGCACAAACTCGAGTTTTGTTGTCCAAGGCTATGGCTGGTGGTGATGTGTTATTGGATGAGTATCTCTATGATGTGGTCAATGGACAAGATTTTAGAGCTACTGTCGCTTTTTTGCGCACCCATGTTATAACAGGCAAAATAAAGGTGACAGCTACCACCAACATTTCTGACAACTCGGGTTGTTGTTTGATGTTGGCCATAAATAGTGGTGTGAGGGGTAAG---TATAGTACTGATGTTTATACTATCTGCTCTCAAGACTCCATGACGTGGAACCCAGGGTGCAAAAAGAACTTCTCGTTCACATTTAATCCAAACCCTTGTGGGGATTCTTGGTCTGCTGAGATGATAAGTCGAAGCAGAGTTAGG------ATGACAGTTATTTGTGTTTCGGGATGGACCTTATCTCCTACCACAGATGTGATTGCCAAGCTAGACTGGTCAATTGTCAATGAGAAATGTGAGCCCACCATTTACCACTTGGCTGATTGTCAGAATTGGTTACCCCTTAATCGTTGGATGGGAAAATTGACTTTTCCCCAGGGTGTGACAAGTGAGGTTCGAAGGATGCCTCTTTCTATAGGAGGCGGTGCTGGTGCGACTCAAGCTTTCTTGGCCAATATGCCCAATTCATGGATATCAATGTGGAGATATTTTAGAGGTGAACTTCACTTTGAAGTTACTAAAATGAGCTCTCCATATATTAAAGCCACTGTTACATTTCTCATAGCTTTTGGTAATCTTAGTGATGCCTTTGGTTTT---------TATGAGAGTTTTCCTCATAGAATTGTTCAATTTGCTGAGGTTGAGGAAAAATGT---ACTTTGGTTTTCTCCCAACAAGAGTTTGTCACTGCTTGGTCAACACAAGTAAACCCCAGAACCACACTTGAAGCAGATGGTTGTCCCTACCTATATGCAATTATTCAT---GATAGTACAACAGGTACAATCTCCGGAGATTTTAATCTTGGGGTCAAGCTTGTTGGCATTAAGGATTTTTGTGGTATAGGTTCTAATCCGGGTATTGATGGTTCCCGCTTGCTTGGAGCTATAGCA
TRN  10010101110011000
NAM  VGNM_CPSMV/437-806
ASQ  D---LFKRNLDDVSTISDTMLGAMIGQTKVVIPKTLVAGTVLKSGPLSDVMQQGSFRSTIALQRTHIITGKIHVVAMLETAVNTGLGLAICFNSGIRGK-ASADIYATCSQDAMIWNPSCTKVMQYAFNPNPCSDGWSLAFLERTGYH--CVVTCVTGWTGTPLQDTFMTINWHISREACVPKIYTIFDPEPDMMLNRWMGRAIFPQQSTQVVRRMPLSIGGGAGAKNSILMNLPNAILSMWRYFKADLEFELIKMSSPYINATIAFFVAFGDLSDDTVN---FEAFPHKLIVFSDKQDRT-TISFSKDEFLMAWSTQVRPDTKLSEDGCPYLYAITH-NGVSSSVEGDFILGIKMVGLKAVENIGVNPGIIGSRLLGAVA
NAM  Q9Z006_9COMO/476-846
ASQ  Q--------TNNFAIESATETMRLLFSGYASIPLNVIPGTKITVAYLN-ELSKHSAVHTGLLNMLSKIPGSLKVKINCQVAPTCGIGLAVSYVEGNESANLGSSLGRLLGIQHYKWNPAIEPYVEFCFQAFFLCRLVEHALFRVFQICSCGGHTDIVQVAERSEVDARISFAIYYEPTITLPKQIATLEHAPAFMFRKELGTLAFKQG-ELVAYSFEVNFGKPQTDGKEVTSTFASAYCGLSQYIQSDVILDFTLMSSPMIGGTFSIAYVAGAYIEKVGNMQILDSLPHIDFTFSSGSKSTRSVRFPKEVFGVYQALDRWDLDSARGDDVSGNFVLYQRDAVSSALEGELTFRIAARLSGDITFTGVSAGYPTTITRIGKG
DSQ  CAG------------------------ACGAACAATTTTGCTATAGAATCAGCCACGGAGACCATGCGCTTGTTATTTAGTGGGTACGCAAGCATTCCTTTGAACGTTATACCGGGTACCAAAATCACGGTGGCCTACTTGAAT---GAATTGTCTAAACATAGTGCAGTGCACACTGGTCTGTTGAATATGTTGAGCAAAATTCCAGGCTCTTTGAAGGTTAAGATTAATTGCCAGGTGGCCCCAACATGTGGAATTGGATTGGCAGTTAGTTATGTTGAAGGAAATGAAAGTGCGAATTTGGGATCTAGCCTGGGACGCTTGTTAGGCATTCAGCACTACAAGTGGAACCCAGCTATAGAACCGTATGTGGAATTTTGTTTTCAAGCCTTTTTCCTGTGCAGATTGGTGGAACATGCATTATTTAGGGTCTTTCAAATATGCTCCTGTGGTGGTCATACAGACATTGTCCAAGTGGCTGAACGCTCCGAAGTGGATGCCAGAATTAGTTTTGCAATATACTATGAGCCTACCATCACATTGCCCAAGCAGATAGCTACCCTAGAGCATGCCCCAGCATTTATGTTTCGCAAGGAGTTAGGGACACTGGCTTTCAAGCAAGGG---GAACTCGTGGCTTACTCATTTGAAGTCAATTTTGGCAAACCACAAACTGACGGAAAGGAAGTGACTTCAACTTTTGCATCGGCTTATTGCGGCCTTAGCCAATATATACAATCAGATGTCATTTTGGATTTTACCCTCATGAGCAGTCCTATGATTGGAGGAACTTTCTCGATTGCATATGTCGCAGGAGCCTACATTGAAAAGGTTGGGAACATGCAAATTCTAGATTCCTTGCCTCACATTGATTTCACATTCTCTTCAGGATCTAAGAGCACGCGCTCTGTGCGATTTCCCAAGGAAGTCTTTGGGGTGTATCAAGCACTTGATAGGTGGGATTTGGATTCGGCAAGAGGAGATGACGTCTCAGGTAATTTTGTGCTTTATCAGAGAGATGCGGTTTCGAGTGCCTTGGAAGGAGAACTTACCTTCAGAATAGCTGCCCGCTTATCTGGAGACATCACCTTTACAGGCGTGAGTGCAGGCTACCCAACGACAATTACGCGCATAGGAAAAGGT
TRN  10010101100011000
NAM  O12663_9COMO/321-691
ASQ  Q--------TNNFAIESATETMRLLFSGHASIPLNVIPGTKITVAYLN-ELSKHSAVHTGLLNMLSKIPGSLKVKINCQVAPTCGIGLAVSYVEGNESANLGSSLGRLLGIQHYKWNPAIEPFVEFIFKPFSCADWWNMHYLGSFKCAPVVVIQTLSKWLNSPKVDARISFAIYYEPSIVLPKQIATLEHAPAFMFRKELGTLAFKQG-ERVAYSFEVNFGKPQTDGKEVTSTFASSYCGLSQYMQSDVILDFTLMSSPMIGGTFSIAYVAGAYIEKVGNMQILDSLPHIDFTFSAGSKSTRSVRFPKEIFGVYQALDRWDLDSARGDDVSGNFVLYQRDAVSSALEGELTFRIAARLSGDINFTGVSAGYPTTITRIGKG
DSQ  CAA------------------------ACAAACAATTTTGCTATAGAGTCAGCCACAGAGACCATGCGTTTGTTGTTTAGTGGACATGCAAGCATTCCACTAAACGTGATACCTGGAACCAAAATTACAGTAGCTTATTTGAAT---GAATTGTCCAAACACAGTGCTGTACACACTGGCTTGCTGAACATGTTGAGTAAAATCCCAGGCTCCTTGAAAGTCAAAATCAATTGTCAGGTAGCTCCAACATGTGGCATAGGATTGGCAGTCAGTTACGTTGAAGGCAATGAAAGTGCGAATTTGGGTTCAAGTTTGGGACGTTTGTTAGGCATTCAACACTATAAGTGGAATCCAGCTATAGAGCCGTTTGTGGAATTTATTTTCAAGCCCTTTTCCTGTGCAGATTGGTGGAACATGCATTATCTAGGATCTTTCAAATGTGCCCCTGTAGTGGTCATACAGACACTGTCTAAGTGGTTGAACTCTCCAAAAGTTGATGCTAGAATTAGCTTTGCAATTTACTACGAGCCTTCCATTGTGTTACCCAAACAAATAGCAACTCTGGAGCATGCCCCAGCGTTCATGTTCCGCAAGGAGCTGGGAACTCTGGCTTTCAAGCAAGGA---GAGCGTGTAGCTTATTCATTTGAGGTCAATTTTGGCAAACCACAAACTGATGGAAAGGAGGTGACTTCAACTTTTGCTTCTTCTTATTGTGGTCTCAGCCAATACATGCAATCGGATGTCATTTTGGATTTTACTCTTATGAGTAGCCCTATGATTGGAGGAACTTTCTCGATTGCATATGTTGCTGGCGCTTACATTGAAAAGGTTGGAAACATGCAAATTCTTGATTCATTGCCCCACATTGATTTCACATTTTCTGCAGGATCTAAGAGTACCCGCTCTGTGCGCTTTCCTAAAGAGATTTTTGGGGTGTATCAGGCACTTGATAGATGGGACTTGGACTCAGCAAGAGGAGATGACGTTTCAGGCAATTTCGTGCTTTATCAGAGAGATGCAGTTTCTAGTGCTTTGGAAGGTGAACTCACATTCAGGATAGCTGCTCGTTTGTCCGGAGATATCAACTTCACAGGAGTTAGCGCAGGTTACCCAACGACGATAACGCGCATAGGGAAAGGC
TRN  10010101100011000
//