EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02244 - Propep_M14)
FAM  PF02244
PID  Propep_M14
DES  Carboxypeptidase activation peptide
IPR  IPR003146
ANO  10
ALN  82
AID  0.322581
APH  ((Q23318_CAEEL/34-111:0.98617,O97434_HELAM/25-99:1.23370):0.18860,(CBPA2_RAT/24-101:0.43438,(CBPA1_RAT/24-101:0.15447,CBPA1_BOVIN/24-101:0.12350):0.12799):0.33046,(((CBPB_CANFA/25-104:0.22122,CBPB_RAT/24-103:0.30063):0.31039,(CBPC_HUMAN/25-104:0.13169,CBPC_MOUSE/25-104:0.17997):0.47680):0.17839,Q15114_HUMAN/27-106:1.40567):0.58550);
ATP  ((Q23318_CAEEL/34-111,O97434_HELAM/25-99),(CBPA2_RAT/24-101,(CBPA1_RAT/24-101,CBPA1_BOVIN/24-101)),(((CBPB_CANFA/25-104,CBPB_RAT/24-103),(CBPC_HUMAN/25-104,CBPC_MOUSE/25-104)),Q15114_HUMAN/27-106));
ATL  7.36953
DNO  10
DLN  246
DID  0.466404
DPH  (O97434_HELAM/25-99:0.63247,Q23318_CAEEL/34-111:0.51270,((Q15114_HUMAN/27-106:0.68384,((CBPB_CANFA/25-104:0.13857,CBPB_RAT/24-103:0.17954):0.19295,(CBPC_HUMAN/25-104:0.06516,CBPC_MOUSE/25-104:0.15639):0.35056):0.11911):0.23541,(CBPA2_RAT/24-101:0.31565,(CBPA1_RAT/24-101:0.12040,CBPA1_BOVIN/24-101:0.11138):0.22477):0.13303):0.09312);
DTP  (O97434_HELAM/25-99,Q23318_CAEEL/34-111,((Q15114_HUMAN/27-106,((CBPB_CANFA/25-104,CBPB_RAT/24-103),(CBPC_HUMAN/25-104,CBPC_MOUSE/25-104))),(CBPA2_RAT/24-101,(CBPA1_RAT/24-101,CBPA1_BOVIN/24-101))));
DTL  4.26505
RID  0.322581
RPH  ((Q23318_CAEEL/34-111:0.98617,O97434_HELAM/25-99:1.23370):0.18860,(CBPA2_RAT/24-101:0.43438,(CBPA1_RAT/24-101:0.15447,CBPA1_BOVIN/24-101:0.12350):0.12799):0.33046,(((CBPB_CANFA/25-104:0.22122,CBPB_RAT/24-103:0.30063):0.31039,(CBPC_HUMAN/25-104:0.13169,CBPC_MOUSE/25-104:0.17997):0.47680):0.17839,Q15114_HUMAN/27-106:1.40567):0.58550);
RTP  ((Q23318_CAEEL/34-111,O97434_HELAM/25-99),(CBPA2_RAT/24-101,(CBPA1_RAT/24-101,CBPA1_BOVIN/24-101)),(((CBPB_CANFA/25-104,CBPB_RAT/24-103),(CBPC_HUMAN/25-104,CBPC_MOUSE/25-104)),Q15114_HUMAN/27-106));
RTL  7.36953
LNK  CBPA1_BOVIN/24-101:P00730:M61851
LNK  CBPA1_RAT/24-101:P00731:V01232
LNK  CBPA2_RAT/24-101:P19222:M23721
LNK  CBPB_CANFA/25-104:P55261:D78348
LNK  CBPB_RAT/24-103:P19223:M23959
LNK  CBPC_HUMAN/25-104:P15088:M27717
LNK  CBPC_MOUSE/25-104:P15089:J05118
LNK  O97434_HELAM/25-99:O97434:AJ005178
LNK  Q15114_HUMAN/27-106:Q15114:M75106
LNK  Q23318_CAEEL/34-111:Q23318:Z75714
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O97434_HELAM/25-99
ASQ  AVYQVDVASMDQVKLVHDFENDL--MLDVWSD-----AVPGRPGKVLVPKFKREIFENFLKQSGVQYKLEVENVKEQLELED
DSQ  GCCGTTTATCAAGTAGATGTTGCCTCAATGGACCAAGTCAAACTGGTCCATGACTTCGAAAATGATTTG------ATGCTCGATGTCTGGTCTGAT---------------GCTGTACCCGGACGCCCTGGCAAAGTCCTCGTCCCCAAATTCAAGAGGGAAATATTTGAAAACTTCCTCAAACAGTCTGGAGTGCAATACAAACTCGAAGTTGAAAATGTTAAAGAACAGCTGGAATTGGAAGAC
TRN  10010101100011001
NAM  CBPA1_BOVIN/24-101
ASQ  QVLRITAADEAEVQTVKELEDLEHLQLDFWRG----PGQPGSPIDVRVPFPSLQAVKVFLEAHGIRYRIMIEDVQSLLDEEQ
DSQ  CAGGTGCTCCGAATCACTGCCGCCGATGAGGCCGAGGTGCAGACGGTGAAGGAGCTGGAGGACCTGGAGCACCTGCAGTTGGACTTCTGGAGGGGC------------CCTGGCCAGCCAGGCTCCCCCATCGACGTCCGAGTGCCCTTCCCCAGCCTCCAGGCTGTTAAAGTCTTCCTGGAAGCCCATGGCATCAGATACAGGATCATGATCGAGGACGTGCAGTCCCTGCTAGACGAGGAGCAG
TRN  10010101100011011
NAM  CBPA1_RAT/24-101
ASQ  QVLRISAADEAQVQKVKELEDLEHLQLDFWRD----AARAGIPIDVRVPFPSIQSVKAFLEYHGISYEIMIEDVQLLLDEEK
DSQ  CAGGTTCTCCGAATCTCTGCAGCCGATGAAGCCCAGGTGCAGAAAGTGAAGGAGTTGGAGGACCTGGAGCACTTGCAGTTGGACTTCTGGCGGGAC------------GCTGCCCGGGCCGGTATCCCCATTGATGTCAGAGTGCCCTTCCCCAGCATCCAATCTGTGAAAGCATTCTTGGAATATCATGGTATTAGCTATGAGATCATGATTGAAGATGTGCAGTTACTGCTCGATGAGGAGAAA
TRN  10010101100011010
NAM  CBPA2_RAT/24-101
ASQ  QVLEIIPSHEEQIRTLLQLEAEEHLELDFWKS----PTIPGETVHVRVPFASIQAVKVFLESQGIDYSIMIEDVQVLLDQER
DSQ  CAAGTTCTTGAGATCATCCCAAGTCATGAAGAGCAAATTAGAACTCTGCTGCAATTGGAGGCTGAAGAGCATCTCGAGCTTGATTTTTGGAAATCA------------CCCACCATCCCGGGGGAGACAGTCCACGTTCGAGTCCCTTTTGCTAGCATCCAGGCTGTCAAGGTTTTCTTGGAGTCCCAGGGGATCGATTATTCCATCATGATCGAAGATGTTCAAGTTCTGTTGGATCAAGAGCGG
TRN  10010101100011001
NAM  Q23318_CAEEL/34-111
ASQ  QVLRAHATDVPQLKALRDIHERTQHDLDFWQT----PSKVGHRADIMVDEDRMEWLDSVLKNSNISYDVIIEDVGKLILEKE
DSQ  CAAGTCCTTCGTGCCCATGCAACCGATGTTCCACAGCTGAAAGCTCTTCGTGATATACATGAGAGGACTCAGCATGATCTTGATTTCTGGCAAACG------------CCGTCAAAAGTTGGCCACCGTGCTGACATAATGGTCGACGAAGATCGAATGGAATGGCTTGATTCCGTTCTGAAAAACTCAAATATCAGCTATGACGTCATTATTGAAGACGTTGGAAAGTTGATTCTAGAAAAGGAA
TRN  10010101100011001
NAM  CBPC_MOUSE/25-104
ASQ  KVFRVKLQNEKHASVLKNLTQSI--ELDFWYPDAIHDIAVNMTVDFRVSEKESQTIQSTLEQHKIHYEILIHDLQEEIEKQF
DSQ  AAGGTATTCCGTGTGAAACTCCAGAATGAAAAGCACGCCAGTGTCTTGAAGAACTTGACCCAAAGCATT------GAGCTCGACTTCTGGTATCCAGATGCTATCCATGATATTGCTGTGAATATGACTGTGGATTTCCGAGTTAGTGAGAAGGAATCTCAGACCATCCAGTCAACCTTGGAACAACATAAAATCCATTATGAAATTCTGATACATGACCTACAAGAAGAGATAGAGAAACAGTTT
TRN  10010101100011001
NAM  CBPC_HUMAN/25-104
ASQ  KVFRVKPQDEKQADIIKDLAKTN--ELDFWYPGATHHVAANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQF
DSQ  AAGGTGTTCCGCGTGAAGCCCCAGGATGAAAAACAAGCAGACATCATAAAGGACTTGGCCAAAACCAAT------GAGCTTGACTTCTGGTATCCAGGTGCCACCCACCACGTAGCTGCTAATATGATGGTGGATTTCCGAGTTAGTGAGAAGGAATCCCAAGCCATCCAGTCTGCCTTGGATCAAAATAAAATGCACTATGAAATCTTGATTCATGATCTACAAGAAGAGATTGAGAAACAGTTT
TRN  10010101110011011
NAM  CBPB_RAT/24-103
ASQ  RVYRVSVHGEDHVNLIQELANTK--EIDFWKPDSATQVKPLTTVDFHVKAEDVADVENFLEENEVHYEVLISNVRNALESQF
DSQ  CGGGTGTACCGTGTCAGTGTACATGGTGAAGATCACGTCAACTTAATTCAGGAGCTAGCCAACACCAAA------GAGATTGATTTCTGGAAACCAGATTCTGCTACACAAGTGAAGCCTCTCACTACAGTTGACTTTCATGTTAAAGCAGAAGATGTTGCTGATGTGGAGAACTTTCTGGAGGAGAATGAAGTTCACTATGAGGTACTGATAAGCAACGTGAGAAATGCTCTGGAATCCCAGTTT
TRN  10010101100011010
NAM  CBPB_CANFA/25-104
ASQ  KVFRVNVEDENHINLLHTLASTT--QIDFWKPDSVTQIKPHSTADFRVKAEDILTVEDFLKQNELHYEVLINNLRLVLEGQF
DSQ  AAGGTGTTCCGCGTCAATGTTGAAGATGAAAATCATATCAACTTACTCCATACATTGGCCAGCACCACC------CAGATTGACTTCTGGAAACCAGATTCTGTCACACAAATCAAACCTCACAGTACAGCTGACTTCCGGGTTAAAGCAGAAGACATTTTGACGGTGGAGGATTTTCTGAAGCAGAATGAACTACACTATGAGGTATTGATAAACAACCTGAGATTGGTGCTGGAAGGTCAGTTT
TRN  10010101100011010
NAM  Q15114_HUMAN/27-106
ASQ  QVLAALPRTSRQVQVLQNLTTTY--EIVLWQPVTADLIVKKKQVHFFVNASDVDNVKAHLNVSGIPCSVLLADVEDLIQQQI
DSQ  CAAGTTCTAGCTGCTCTTCCTAGAACCTCTAGGCAAGTTCAAGTTCTACAGAATCTTACTACAACATAT------GAGATTGTTCTCTGGCAGCCGGTAACAGCTGACCTTATTGTGAAGAAAAAACAAGTCCATTTTTTTGTAAATGCATCTGATGTCGACAATGTGAAAGCCCATTTAAATGTGAGCGGAATTCCATGCAGTGTCTTGCTGGCAGACGTGGAAGATCTTATTCAACAGCAGATT
TRN  10010101100011010
//