EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02218 - HS1_rep)
FAM  PF02218
PID  HS1_rep
DES  Repeat in HS1/Cortactin
IPR  IPR003134
ANO  18
ALN  37
AID  0.640784
APH  ((((O96046_DROME/158-194:0.05648,O96046_DROME/121-157:0.15184):0.09310,O70420_RAT/231-267:0.14438):0.03473,(((HCLS1_HUMAN/119-155:0.24859,(((HCLS1_HUMAN/156-192:0.25485,O70419_RAT/194-230:0.14005):0.07076,SRC8_HUMAN/157-193:0.03451):0.05314,O70419_RAT/120-156:0.14917):0.00000):0.03021,((O96459_STRPU/120-156:0.08172,O96459_STRPU/194-230:0.03177):0.10378,O96459_STRPU/231-267:0.11179):0.05389):0.10468,((((HCLS1_HUMAN/82-118:0.27483,O70419_RAT/83-119:0.15052):0.11677,O96459_STRPU/83-119:0.13239):0.09231,O96046_DROME/84-120:0.13381):0.08021,O96459_STRPU/157-193:0.27149):0.05966):0.08420):0.17087,SRC8_CHICK/277-313:0.00000,SRC8_MOUSE/268-304:0.13855);
ATP  ((((O96046_DROME/158-194,O96046_DROME/121-157),O70420_RAT/231-267),(((HCLS1_HUMAN/119-155,(((HCLS1_HUMAN/156-192,O70419_RAT/194-230),SRC8_HUMAN/157-193),O70419_RAT/120-156)),((O96459_STRPU/120-156,O96459_STRPU/194-230),O96459_STRPU/231-267)),((((HCLS1_HUMAN/82-118,O70419_RAT/83-119),O96459_STRPU/83-119),O96046_DROME/84-120),O96459_STRPU/157-193))),SRC8_CHICK/277-313,SRC8_MOUSE/268-304);
ATL  3.70545
DNO  18
DLN  111
DID  0.637755
DPH  (((((O70419_RAT/120-156:0.10183,((((HCLS1_HUMAN/82-118:0.30517,O96046_DROME/84-120:0.16827):0.02145,(O96459_STRPU/83-119:0.15670,O70419_RAT/83-119:0.25676):0.07782):0.06575,(O96046_DROME/121-157:0.13102,O96046_DROME/158-194:0.15067):0.11000):0.02080,(O96459_STRPU/157-193:0.35002,(O70420_RAT/231-267:0.15891,(SRC8_CHICK/277-313:0.07285,SRC8_MOUSE/268-304:0.12398):0.17250):0.07418):0.02886):0.05416):0.04235,((HCLS1_HUMAN/156-192:0.19217,O70419_RAT/194-230:0.19334):0.05041,SRC8_HUMAN/157-193:0.14307):0.05003):0.04322,HCLS1_HUMAN/119-155:0.23988):0.09373,O96459_STRPU/231-267:0.21965):0.11993,O96459_STRPU/120-156:0.11218,O96459_STRPU/194-230:0.09965);
DTP  (((((O70419_RAT/120-156,((((HCLS1_HUMAN/82-118,O96046_DROME/84-120),(O96459_STRPU/83-119,O70419_RAT/83-119)),(O96046_DROME/121-157,O96046_DROME/158-194)),(O96459_STRPU/157-193,(O70420_RAT/231-267,(SRC8_CHICK/277-313,SRC8_MOUSE/268-304))))),((HCLS1_HUMAN/156-192,O70419_RAT/194-230),SRC8_HUMAN/157-193)),HCLS1_HUMAN/119-155),O96459_STRPU/231-267),O96459_STRPU/120-156,O96459_STRPU/194-230);
DTL  4.20131
RID  0.640784
RPH  ((((O96046_DROME/158-194:0.05648,O96046_DROME/121-157:0.15184):0.09310,O70420_RAT/231-267:0.14438):0.03473,(((HCLS1_HUMAN/119-155:0.24859,(((HCLS1_HUMAN/156-192:0.25485,O70419_RAT/194-230:0.14005):0.07076,SRC8_HUMAN/157-193:0.03451):0.05314,O70419_RAT/120-156:0.14917):0.00000):0.03021,((O96459_STRPU/120-156:0.08172,O96459_STRPU/194-230:0.03177):0.10378,O96459_STRPU/231-267:0.11179):0.05389):0.10468,((((HCLS1_HUMAN/82-118:0.27483,O70419_RAT/83-119:0.15052):0.11677,O96459_STRPU/83-119:0.13239):0.09231,O96046_DROME/84-120:0.13381):0.08021,O96459_STRPU/157-193:0.27149):0.05966):0.08420):0.17087,SRC8_CHICK/277-313:0.00000,SRC8_MOUSE/268-304:0.13855);
RTP  ((((O96046_DROME/158-194,O96046_DROME/121-157),O70420_RAT/231-267),(((HCLS1_HUMAN/119-155,(((HCLS1_HUMAN/156-192,O70419_RAT/194-230),SRC8_HUMAN/157-193),O70419_RAT/120-156)),((O96459_STRPU/120-156,O96459_STRPU/194-230),O96459_STRPU/231-267)),((((HCLS1_HUMAN/82-118,O70419_RAT/83-119),O96459_STRPU/83-119),O96046_DROME/84-120),O96459_STRPU/157-193))),SRC8_CHICK/277-313,SRC8_MOUSE/268-304);
RTL  3.70545
LNK  HCLS1_HUMAN/119-155:P14317:X16663
LNK  HCLS1_HUMAN/156-192:P14317:X16663
LNK  HCLS1_HUMAN/82-118:P14317:X16663
LNK  O70419_RAT/120-156:O70419:AF054618
LNK  O70419_RAT/194-230:O70419:AF054618
LNK  O70419_RAT/83-119:O70419:AF054618
LNK  O70420_RAT/231-267:O70420:AF054619
LNK  O96046_DROME/121-157:O96046:AB009998
LNK  O96046_DROME/158-194:O96046:AB009998
LNK  O96046_DROME/84-120:O96046:AB009998
LNK  O96459_STRPU/120-156:O96459:AF064260
LNK  O96459_STRPU/157-193:O96459:AF064260
LNK  O96459_STRPU/194-230:O96459:AF064260
LNK  O96459_STRPU/231-267:O96459:AF064260
LNK  O96459_STRPU/83-119:O96459:AF064260
LNK  SRC8_CHICK/277-313:Q01406:M73705
LNK  SRC8_HUMAN/157-193:Q14247:M98343
LNK  SRC8_MOUSE/268-304:Q60598:U03184
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SRC8_HUMAN/157-193
ASQ  GFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSK
DSQ  GGTTTTGGCGGCAAGTATGGCGTGCAGGCCGACCGAGTAGACAAGAGCGCGGTGGGCTTCGACTACCAGGGCAAGACGGAGAAGCACGAGTCACAGAGAGATTACTCCAAA
TRN  10110101110011001
NAM  O70419_RAT/120-156
ASQ  GFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSS
DSQ  GGCTTCGGAGGCAAGTTCGGTGTCCAGATGGACAGGGTGGATCAGTCTGCTGTAGGCTTTGAATACCAGGGGAAGACGGAGAAGCACGCCTCCCAGAAAGACTACTCCAGT
TRN  10110101110011011
NAM  O70419_RAT/194-230
ASQ  GFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVK
DSQ  GGTTTTGGTGGCAAATACGGAATTGACAAGGACAAGGTGGATAAAAGCGCTGTGGGCTTTGAGTATCAAGGCAAAACAGAGAAGCATGAGTCCCAGAAAGACTATGTAAAA
TRN  11111101111011011
NAM  O96459_STRPU/231-267
ASQ  GFGGKYGVQKDSQDSSAVGFDYEGKTEKHASQTDSSK
DSQ  GGGTTTGGTGGGAAATACGGCGTGCAGAAGGATAGCCAGGATTCATCAGCTGTCGGGTTTGACTACGAAGGCAAGACGGAAAAGCATGCATCACAGACGGACTCGAGTAAG
TRN  11111101111011001
NAM  O96459_STRPU/194-230
ASQ  GFGGKHGVQTDRQDASAVGFDYEGKTEKHASHKDYSS
DSQ  GGTTTCGGTGGCAAGCACGGCGTGCAGACTGACCGCCAAGACGCTTCGGCTGTTGGATTCGACTATGAAGGAAAGACAGAGAAACACGCCTCGCATAAAGATTATTCCAGC
TRN  11111101111011011
NAM  O96459_STRPU/120-156
ASQ  GFGGKHGVQSDRQDASAVGFDYEGKTDKPASQKDYSS
DSQ  GGGTTCGGAGGCAAGCACGGCGTGCAGTCTGACCGCCAAGACGCTTCTGCTGTCGGATTTGATTACGAGGGGAAGACGGATAAACCTGCTTCACAAAAAGATTATTCCTCA
TRN  11111101111011001
NAM  HCLS1_HUMAN/119-155
ASQ  GFGGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYSR
DSQ  GGCTTTGGGGGCAAGTACGGAGTTGAGAGGGACAGGGCAGACAAGTCAGCAGTCGGCTTTGATTATAAAGGAGAAGTGGAGAAGCATACATCTCAGAAAGATTACTCTCGT
TRN  10110101110011001
NAM  SRC8_MOUSE/268-304
ASQ  GFGGKFGVQSERQDSSAVGFDYKERLAKHEPQQDYAK
DSQ  GGTTTCGGAGGCAAATTTGGTGTTCAGTCCGAGAGGCAGGACTCCTCCGCTGTGGGGTTTGATTACAAGGAGAGATTGGCCAAGCACGAGCCCCAGCAAGACTATGCCAAA
TRN  10110101110011011
NAM  SRC8_CHICK/277-313
ASQ  GFGGKFGVQTERQDPSAVGFDYKEKLAKHESQQDYSK
DSQ  GGTTTCGGAGGGAAATTTGGTGTACAGACAGAAAGGCAGGACCCATCTGCTGTGGGGTTTGATTACAAGGAGAAACTAGCCAAGCATGAATCTCAACAAGATTATTCAAAA
TRN  10010101110011001
NAM  O96046_DROME/158-194
ASQ  GFGGKFGVQSDRVDKSAVGWDHIEKVEKHESQKDYSK
DSQ  GGCTTCGGAGGCAAATTTGGAGTGCAGTCCGATCGGGTGGATAAATCCGCCGTGGGCTGGGATCACATCGAGAAGGTGGAGAAGCACGAGTCTCAGAAGGATTACTCCAAG
TRN  11111101111011011
NAM  O96046_DROME/121-157
ASQ  GFGGKFGVQEDRKDKSAVGWDHVEKVEKHASQKDYAT
DSQ  GGTTTTGGGGGAAAGTTCGGAGTGCAAGAGGATCGCAAGGACAAGTCTGCCGTGGGCTGGGACCACGTCGAAAAGGTCGAGAAGCACGCCTCCCAGAAGGATTACGCCACC
TRN  11111111111111111
NAM  O70420_RAT/231-267
ASQ  GFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYAK
DSQ  GGCTTTGGAGGAAAGTTTGGTGTGCAGACAGACAGACAGGACAAGTGTGCCCTTGGCTGGGACCATCAGGAGAAGCTGCAGCTGCATGAATCCCAAAAAGACTATGCCAAA
TRN  10010101100011011
NAM  O96459_STRPU/157-193
ASQ  GFGGKFGVQKQSMDKSAVGWDYQAGLSQHNSQKDYST
DSQ  GGTTTTGGAGGGAAGTTTGGAGTGCAGAAGCAGAGCATGGATAAGAGTGCTGTTGGATGGGACTACCAAGCAGGTTTATCACAACACAACTCACAGAAAGATTATTCTACC
TRN  11111101111011000
NAM  O96046_DROME/84-120
ASQ  GYGGKFGVEKDRMDKSAVGHDYQGKVGKHASQKDYSD
DSQ  GGATACGGCGGCAAGTTTGGCGTTGAGAAGGACCGCATGGACAAGTCGGCTGTGGGTCATGACTACCAGGGCAAGGTGGGAAAGCACGCCTCGCAGAAGGACTACAGCGAT
TRN  11111111111111111
NAM  O70419_RAT/83-119
ASQ  GYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVR
DSQ  GGCTATGGCGGGAAGTTTGGTGTGGAGCAAGATAGGATGGACAAATCAGCTGTGGGCCATGAGTACCAGTCAAAGCTCTCCAAGCACTGCTCACAAGTGGACTCAGTCCGG
TRN  10010101110011001
NAM  O96459_STRPU/83-119
ASQ  GYGGKFGVQQDRMDKSAVGHDHQESLNKHASQADYAK
DSQ  GGCTATGGAGGAAAGTTTGGTGTTCAACAGGACAGGATGGACAAGTCTGCCGTGGGGCATGACCATCAGGAATCACTTAACAAGCATGCATCTCAGGCAGACTACGCCAAG
TRN  10010101110011001
NAM  HCLS1_HUMAN/82-118
ASQ  GYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAK
DSQ  GGCTATGGAGGTCGGTTTGGAGTAGAAAGAGACCGAATGGACAAGAGTGCAGTGGGCCATGAGTATGTTGCCGAGGTGGAGAAGCACTCTTCTCAGACGGATGCTGCCAAA
TRN  10110101110011011
NAM  HCLS1_HUMAN/156-192
ASQ  GFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAK
DSQ  GGCTTTGGTGGCCGGTACGGGGTGGAGAAGGATAAATGGGACAAAGCAGCTCTGGGATATGACTACAAGGGAGAGACGGAGAAACACGAGTCCCAGAGAGATTATGCCAAG
TRN  10010101100011011
//