EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02200 - STE)
FAM  PF02200
PID  STE
DES  STE like transcription factor
IPR  IPR003120
ANO  4
ALN  111
AID  0.689774
APH  ((STEA_EMENI/56-165:0.09282,O42722_CRYNE/91-200:0.22699):0.24575,CPH1_CANAL/44-154:0.18909,STE12_KLULA/51-161:0.09181);
ATP  ((STEA_EMENI/56-165,O42722_CRYNE/91-200),CPH1_CANAL/44-154,STE12_KLULA/51-161);
ATL  0.84646
DNO  4
DLN  333
DID  0.61309
DPH  ((STEA_EMENI/56-165:11.82251,O42722_CRYNE/91-200:21.40587):13.80785,CPH1_CANAL/44-154:14.81549,STE12_KLULA/51-161:7.35615);
DTP  ((STEA_EMENI/56-165,O42722_CRYNE/91-200),CPH1_CANAL/44-154,STE12_KLULA/51-161);
DTL  69.2035
RID  0.689774
RPH  ((STEA_EMENI/56-165:0.09282,O42722_CRYNE/91-200:0.22699):0.24575,CPH1_CANAL/44-154:0.18909,STE12_KLULA/51-161:0.09181);
RTP  ((STEA_EMENI/56-165,O42722_CRYNE/91-200),CPH1_CANAL/44-154,STE12_KLULA/51-161);
RTL  0.84646
LNK  CPH1_CANAL/44-154:P43079:U15152
LNK  O42722_CRYNE/91-200:O42722:AF012924
LNK  STE12_KLULA/51-161:Q08400:L21156
LNK  STEA_EMENI/56-165:O74252:AF080600
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  STEA_EMENI/56-165
ASQ  DQLIRRFLLPTGD-YISCVLWSNLFHISGTDIVRCLAFRFQAFGRPVKNSKKFEEGIFSDLRNLKAGTDATLEEPKSPFLDFLYKNNCIRTQKKQKVFYWYSVPHDRLFLD
DSQ  GACCAGCTCATCCGAAGATTTCTTCTCCCGACTGGTGAT---TATATCTCATGTGTACTTTGGAGCAACCTGTTCCACATCTCAGGTACCGATATCGTTCGGTGCCTGGCATTCAGATTCCAAGCCTTTGGCCGTCCTGTCAAGAATTCTAAAAAATTCGAGGAGGGCATCTTTTCTGATTTGCGAAACCTGAAAGCTGGGACCGATGCTACGCTCGAAGAACCGAAAAGCCCGTTCCTTGATTTTCTTTACAAGAACAATTGCATCCGAACTCAGAAGAAGCAGAAGGTCTTCTATTGGTATAGTGTGCCTCATGACAGGCTGTTTCTCGAT
TRN  10010101100011001
NAM  O42722_CRYNE/91-200
ASQ  HPNLNRFLLPNGE-YVACVFWNGLYHITGTDIIRALVFRFKAFSRPVRNMKKFEEGVFSDLRNLKPGTDACLEEPKSPFLDLLFRNGCIRTQKKQKVFYWFSVPHDRLFLD
DSQ  CATCCCAACTTGAATCGTTTCCTCTTGCCAAACGGCGAG---TATGTAGCTTGTGTCTTCTGGAATGGGCTGTATCACATTACTGGTACCGACATAATCAGAGCATTGGTCTTTCGTTTTAAGGCCTTTTCCAGGCCTGTACGGAATATGAAAAAATTCGAAGAAGGCGTATTCTCTGATCTGAGGAATCTCAAACCGGGGACAGATGCTTGTCTTGAGGAACCTAAGTCACCTTTCCTTGACCTTTTGTTCCGCAATGGCTGTATTAGGACGCAAAAAAAGCAAAAGGTATTCTACTGGTTCTCGGTGCCTCATGATCGATTGTTTCTAGAC
TRN  10010101100011001
NAM  STE12_KLULA/51-161
ASQ  NQVIRRYYLSNDEGFVSCVFWNNLYYITGTDIVRCCAYRMQKFGREIVERKKFEEGIFSDLRNLKCGIDATLEKPKSDLLAFLYKNMCLKTQKKQKVFFWFSVPHDRLFAD
DSQ  AATCAAGTAATCAGGCGGTATTATTTGAGTAATGACGAAGGATTTGTATCGTGTGTGTTTTGGAACAATTTATACTATATTACAGGGACAGATATCGTCAGGTGCTGCGCATATAGGATGCAGAAATTTGGTAGAGAGATTGTAGAAAGGAAAAAATTTGAAGAAGGTATCTTTTCAGATCTACGAAACTTGAAATGTGGCATTGATGCAACTCTTGAGAAACCTAAATCGGACTTACTTGCATTCCTATATAAGAACATGTGTCTGAAGACACAAAAGAAGCAGAAGGTTTTCTTTTGGTTCAGTGTACCACATGACAGATTATTTGCAGAT
TRN  10010101100011000
NAM  CPH1_CANAL/44-154
ASQ  NQVIRRYYLNHDEGFVSCVYWNNLYFITGTDIVRCIVYKFEHFGRKIIDRKKFEEGIFSDLRNLKCGADAILEPPRSEFLEFLFKNSCLRTQKKQKVFFWFNVPHDKLMAD
DSQ  AATCAAGTGATTCGAAGATACTATTTAAACCACGATGAAGGTTTTGTCAGTTGTGTTTATTGGAATAACTTATATTTTATCACTGGTACCGATATCGTCCGTTGTATCGTTTATAAATTTGAACATTTTGGAAGGAAAATCATTGATCGGAAAAAGTTTGAAGAAGGTATTTTCTCCGATTTAAGAAATTTGAAATGTGGCGCCGATGCAATTTTGGAACCTCCTCGTTCAGAGTTTTTAGAATTCTTATTTAAAAATTCTTGTTTGAGAACACAAAAGAAACAAAAAGTGTTTTTTTGGTTTAATGTTCCTCATGATAAGTTAATGGCAGAT
TRN  10110101110011000
//