EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02182 - YDG_SRA)
FAM  PF02182
PID  YDG_SRA
DES  YDG/SRA domain
IPR  IPR003105
ANO  4
ALN  167
AID  0.464403
APH  ((SUVH6_ARATH/325-486:0.18981,SUVH5_ARATH/360-519:0.19101):0.24423,SUVH2_ARATH/202-358:0.45033,O81463_ARATH/228-374:1.32917);
ATP  ((SUVH6_ARATH/325-486,SUVH5_ARATH/360-519),SUVH2_ARATH/202-358,O81463_ARATH/228-374);
ATL  2.40455
DNO  4
DLN  501
DID  0.511825
DPH  ((SUVH2_ARATH/202-358:0.37090,O81463_ARATH/228-374:0.77346):0.26555,SUVH6_ARATH/325-486:0.19130,SUVH5_ARATH/360-519:0.12602);
DTP  ((SUVH2_ARATH/202-358,O81463_ARATH/228-374),SUVH6_ARATH/325-486,SUVH5_ARATH/360-519);
DTL  73.4453
RID  0.464403
RPH  ((SUVH6_ARATH/325-486:0.18981,SUVH5_ARATH/360-519:0.19101):0.24423,SUVH2_ARATH/202-358:0.45033,O81463_ARATH/228-374:1.32917);
RTP  ((SUVH6_ARATH/325-486,SUVH5_ARATH/360-519),SUVH2_ARATH/202-358,O81463_ARATH/228-374);
RTL  2.40455
LNK  O81463_ARATH/228-374:O81463:AF076275
LNK  SUVH2_ARATH/202-358:O22781:AF344445
LNK  SUVH5_ARATH/360-519:O82175:AF344448
LNK  SUVH6_ARATH/325-486:Q8VZ17:AF344449
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SUVH5_ARATH/360-519
ASQ  GTQIIGTVPGVEVGDEFQYRMELNLLGIHRPSQSGIDYMK---DDGGELVATSIVSSGGYNDVLDNSDVLIYTGQGGNVG--KKK--NNEPPKDQQLVTGNLALKNSINKKNPVRVIRGIKNTTLQSSVVAKNYVYDGLYLVEEYWEETGSHGKLVFKFKLRRIPGQ
DSQ  GGTACTCAGATTATTGGAACTGTGCCTGGTGTTGAGGTTGGCGATGAATTTCAATATAGAATGGAGCTGAACCTTCTTGGTATACATAGACCAAGTCAAAGTGGTATCGACTATATGAAA---------GATGACGGTGGGGAACTAGTTGCCACGAGTATTGTATCCTCGGGAGGTTATAATGACGTGCTTGATAACTCTGATGTCTTGATCTACACGGGTCAAGGCGGAAATGTGGGG------AAAAAGAAA------AATAATGAACCACCCAAAGACCAGCAGCTTGTAACGGGAAACCTTGCGTTGAAAAACAGTATAAACAAAAAGAACCCTGTGCGGGTCATAAGAGGCATCAAAAATACGACATTACAATCATCAGTTGTTGCAAAGAATTATGTTTACGATGGATTGTATCTGGTGGAAGAGTACTGGGAAGAAACCGGGTCTCACGGTAAACTCGTCTTCAAGTTCAAACTACGGCGTATTCCTGGACAA
TRN  10010101100011000
NAM  SUVH6_ARATH/325-486
ASQ  GVHILGEVPGVEVGDEFQYRMELNILGIHKPSQAGIDYMK----YGKAKVATSIVASGGYDDHLDNSDVLTYTGQGGNVMQVKKKGEELKEPEDQKLITGNLALATSIEKQTPVRVIRGKHKSTHDKS-KGGNYVYDGLYLVEKYWQQVGSHGMNVFKFQLRRIPGQ
DSQ  GGTGTGCATATTTTGGGAGAAGTGCCTGGGGTTGAGGTTGGTGATGAGTTCCAATATAGGATGGAGCTGAACATTCTTGGTATACATAAACCAAGCCAGGCCGGTATCGATTATATGAAA------------TATGGTAAGGCCAAAGTTGCGACAAGTATTGTAGCCTCTGGAGGGTATGACGACCATCTGGATAACTCGGATGTCTTGACCTACACTGGTCAAGGCGGAAACGTGATGCAAGTAAAGAAGAAGGGAGAGGAACTGAAAGAGCCTGAAGACCAAAAGCTTATTACCGGAAACCTCGCGTTAGCAACCAGCATAGAAAAACAAACCCCTGTGCGTGTCATTAGAGGCAAACATAAGTCAACTCATGATAAATCA---AAAGGTGGAAATTATGTTTACGACGGATTATATCTTGTGGAAAAGTATTGGCAACAAGTCGGATCTCACGGTATGAATGTCTTCAAGTTTCAACTTAGGCGCATACCTGGACAA
TRN  10010101100011000
NAM  SUVH2_ARATH/202-358
ASQ  DKHIVGPVTGVEVGDIFFYRMELCVLGLHGQTQAGIDCLTAERSATGEPIATSIVVSGGYEDDEDTGDVLVYTGHGGQDH-------QHKQCDNQRLVGGNLGMERSMHYGIEVRVIRGIK---YENSISSKVYVYDGLYKIVDWWFAVGKSGFGVFKFRLVRIEGQ
DSQ  GATAAGCACATAGTTGGTCCAGTCACAGGGGTTGAAGTAGGGGATATATTCTTCTACCGTATGGAATTGTGTGTGCTGGGCTTACACGGCCAGACACAAGCCGGGATTGATTGTTTAACGGCTGAACGGAGCGCCACTGGAGAGCCTATAGCTACCAGCATTGTTGTCTCAGGTGGTTATGAGGATGATGAAGATACAGGAGATGTTTTGGTTTATACTGGTCACGGTGGTCAGGATCAT---------------------CAACACAAGCAGTGTGATAACCAGAGGCTAGTAGGTGGGAATCTGGGAATGGAGAGAAGTATGCACTACGGTATCGAGGTACGTGTGATTAGAGGTATTAAG---------TATGAGAACAGTATAAGCTCGAAGGTGTATGTATATGATGGTTTGTATAAGATAGTAGATTGGTGGTTTGCTGTGGGGAAGTCTGGTTTTGGGGTTTTTAAATTTAGGTTAGTAAGAATTGAAGGGCAA
TRN  10010101100011000
NAM  O81463_ARATH/228-374
ASQ  AEHDPVRNQGVLVGESWENRVECRQWGVHLPHVSCIAGQE-------DYGAQSVVISGGYKDDEDHGEWFLYTGRSRG---------RHFANEDQEFEDLNEALRVSCEMGYPVRVVRSYKDR-YSAYAPKEGVRYDGVYRIEKCWRKARFP---VCRYLFVRCDNE
DSQ  GCTGAACATGATCCTGTCAGGAACCAAGGTGTTTTAGTTGGAGAATCCTGGGAGAATCGAGTAGAGTGTCGGCAGTGGGGGGTTCACTTGCCACATGTTTCTTGCATTGCTGGACAAGAA---------------------GACTATGGAGCTCAGTCTGTAGTAATATCTGGAGGTTATAAGGATGACGAGGATCATGGAGAATGGTTTCTATACACAGGAAGGAGTAGAGGG---------------------------AGACATTTCGCTAACGAGGATCAGGAGTTTGAAGACTTGAATGAAGCTTTAAGAGTTAGTTGCGAAATGGGGTATCCAGTTCGAGTTGTCAGGTCTTACAAGGATAGG---TATTCTGCATATGCCCCTAAGGAAGGAGTGAGATATGATGGTGTATACAGGATCGAGAAATGCTGGCGAAAAGCTAGATTCCCG---------GTCTGTCGTTACCTGTTTGTAAGATGTGACAATGAG
TRN  10010101100011010
//