EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02155 - GCR)
FAM  PF02155
PID  GCR
DES  Glucocorticoid receptor
IPR  IPR001409
ANO  2
ALN  386
AID  0.518293
APH  (GCR_XENLA/29-401:0.59380,GCR_SAISC/26-401:0.22044);
ATP  (GCR_XENLA/29-401,GCR_SAISC/26-401);
ATL  0.81424
DNO  2
DLN  1158
DID  0.59045
DPH  (GCR_XENLA/29-401:0.43318,GCR_SAISC/26-401:0.16711);
DTP  (GCR_XENLA/29-401,GCR_SAISC/26-401);
DTL  0.60029
RID  0.518293
RPH  (GCR_XENLA/29-401:0.59380,GCR_SAISC/26-401:0.22044);
RTP  (GCR_XENLA/29-401,GCR_SAISC/26-401);
RTL  0.81424
LNK  GCR_SAISC/26-401:O46567:AF041834
LNK  GCR_XENLA/29-401:P49844:X72211
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  GCR_XENLA/29-401
ASQ  VIEFFGNYRGGVSVSVSASCP-TSTASQSNTRQQQHFQKQLTATGDSTNGLNNNVPQPDLSKAVSLSMGLYMGESDTKVMSSDIAFPSQEQIGISTGETDFSLLEESIANLQAKSLAPDKLIEISE-----DP---GGFKCD--ISAQPRPSMGQGGSNGSSSTNLFPKDQCTFDLLRDLGISPDSP-LDGKSNPWLDPLFDEQEAFNLLSPLGTGDPFFMKSEVLSEGSKTLSLEDGTQRLGDHAKDMLLPSADRPISQVKTEKEDYIELCTPGVVNEEKFGPVYCVGNFSGSGLFGNKSSAISVHGVSTSGGQMYHYDLNTATISQQ-DVKPVFNLGSPGTSIAEGWNRCHGSGNDTAASPGNVNFPNRSVFSNGYSSPGIRSD
DSQ  GTGATTGAATTCTTTGGAAATTATAGGGGAGGAGTTAGTGTGAGCGTCTCTGCATCTTGCCCA---ACCTCAACTGCTTCACAGTCAAACACTAGGCAGCAGCAGCATTTTCAAAAACAGCTGACTGCGACTGGGGACTCAACTAATGGATTGAATAATAATGTGCCTCAGCCAGATTTATCTAAAGCAGTCTCGCTCTCAATGGGACTCTACATGGGGGAGTCAGACACAAAAGTGATGAGCAGTGATATCGCCTTTCCATCCCAAGAGCAAATTGGTATCTCCACAGGAGAAACTGATTTTAGTCTCTTGGAGGAGAGCATTGCCAACTTGCAGGCTAAGTCATTGGCCCCAGATAAACTCATAGAGATCTCAGAG---------------GATCCT---------GGGGGTTTTAAATGTGAC------ATATCTGCCCAACCAAGGCCTTCCATGGGTCAAGGGGGCAGCAATGGGAGCAGCTCTACCAATCTGTTCCCCAAAGACCAATGCACCTTTGACCTACTACGGGACCTGGGTATCTCCCCAGACTCACCC---CTGGACGGTAAATCAAATCCTTGGCTAGACCCACTTTTTGACGAGCAGGAAGCATTTAACCTGTTGTCCCCACTGGGCACCGGTGATCCTTTTTTCATGAAATCTGAAGTACTGAGCGAGGGTAGCAAAACTCTCAGCCTCGAGGATGGCACACAGAGACTCGGTGATCATGCCAAGGACATGCTGTTGCCCAGTGCAGACCGGCCAATTTCTCAAGTCAAGACAGAAAAGGAAGACTACATTGAGCTATGTACACCTGGCGTGGTGAATGAGGAAAAATTTGGTCCTGTGTATTGTGTAGGCAATTTTTCTGGATCTGGCTTATTTGGTAACAAATCTTCAGCTATTTCTGTCCATGGCGTCAGCACTTCAGGTGGGCAGATGTACCACTATGACTTGAACACTGCCACCATCTCGCAACAG---GATGTTAAGCCAGTCTTTAATCTTGGCTCACCTGGGACTAGCATTGCAGAAGGCTGGAATAGGTGCCATGGATCTGGGAACGACACTGCCGCTTCTCCAGGGAATGTCAATTTTCCAAACAGATCTGTTTTTTCAAATGGCTATTCAAGCCCCGGAATAAGATCTGAT
TRN  10010101100011000
NAM  GCR_SAISC/26-401
ASQ  VMDFCKILRGGATLKVSVSSTSLAAASQSDSKQQ-------RLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLQLLEESIANLNRSTSVPENPKSSASSSVSAAPKEKEFPKTHSDVSSEQQNLKGQTGTNG-GNVKLYTADQSTFDILQDLEFSSGSPGKETNQSPWKSDLLIDENC--LLSPLAGEEDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSSSNVTLPQVKTEKEDFIELCTPGVIKQEKLSTVYCQASFPGANIIGNKMSAISIHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPD
DSQ  GTGATGGACTTCTGTAAAATCCTAAGGGGAGGAGCTACTCTGAAGGTTTCTGTATCTTCAACCTCACTGGCTGCTGCATCTCAGTCAGACTCCAAGCAGCAA---------------------AGACTTTTGGTTGATTTTCCGAAAGGCTCAGTAAGCAATGCGCAACAGCCAGATCTGTCCAAAGCAGTTTCACTCTCGATGGGACTCTATATGGGAGAAACAGAAACAAAAGTAATGGGAAATGACCTGGGATTCCCACAGCAGGGCCAAATCAGCCTCTCCTCAGGGGAAACAGACTTACAGCTTCTGGAAGAAAGCATTGCAAACCTCAATAGGTCGACCAGTGTTCCAGAGAACCCCAAGAGTTCAGCATCCTCTTCCGTGTCTGCTGCCCCCAAAGAGAAGGAGTTTCCAAAAACTCATTCTGATGTGTCTTCAGAACAACAAAATTTGAAGGGCCAGACTGGCACCAACGGT---GGCAATGTGAAATTGTATACCGCAGACCAAAGCACCTTTGACATTTTGCAGGATTTGGAGTTTTCTTCTGGGTCCCCAGGTAAAGAGACGAATCAGAGTCCTTGGAAATCAGACCTGTTGATAGATGAAAACTGT------TTGCTTTCTCCTCTGGCGGGAGAAGAGGATTCATTCCTTTTGGAAGGAAACTCGAATGAGGACTGCAAGCCTCTCATTTTACCGGACACTAAACCTAAAATTAAGGATAATGGAGATCTGGTTTTGTCAAGCTCCAGTAATGTAACACTGCCCCAAGTGAAAACAGAAAAAGAAGATTTCATCGAACTCTGTACCCCTGGGGTAATTAAGCAAGAGAAACTGAGCACAGTTTACTGTCAGGCAAGCTTTCCTGGAGCAAATATAATTGGTAATAAAATGTCTGCCATTTCTATTCATGGTGTGAGTACCTCTGGAGGACAGATGTACCACTATGACATGAATACAGCATCCCTTTCTCAACAGCAGGATCAGAAGCCTATTTTTAATGTCATTCCACCAATTCCTGTTGGTTCCGAAAATTGGAATAGGTGCCAAGGGTCTGGAGACGACAACTTGACTTCCTTGGGGACTCTGAACTTCCCTGGTCGAACAGTTTTTTCTAATGGCTATTCAAGCCCCAGCATGAGACCAGAT
TRN  10010101100011000
//