EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02152 - FolB)
FAM  PF02152
PID  FolB
DES  Dihydroneopterin aldolase
IPR  IPR006157
ANO  18
ALN  118
AID  0.233427
APH  (((((FOLX_ECOLI/7-117:0.79320,((FAS_YEAST/189-297:1.06037,O75013_SCHPO/132-232:0.67539):0.25202,FAS_PNECA/163-276:0.53215):0.36696):0.22115,((FOLB_HAEIN/4-114:0.32134,FOLB_ECOLI/4-114:0.24901):0.36873,((O75013_SCHPO/8-120:1.21678,FAS_PNECA/41-152:0.52894):0.38418,FAS_YEAST/64-178:0.72364):0.45171):0.13186):0.09845,Q9ZJB0_HELPJ/7-113:1.77063):0.31431,(SULD_STRPN/4-117:1.03518,(FOLB_METEX/5-118:0.59982,((FOLB_MYCTU/5-117:0.68482,FOLB_SYNY3/4-116:0.52684):0.09750,(FOLB_STRPY/4-117:0.67981,FOLB_BACSU/4-117:0.34941):0.17010):0.13343):0.10030):0.12526):0.85626,FOLB_CHLPN/9-124:0.44025,FOLB_CHLTR/6-121:0.34232);
ATP  (((((FOLX_ECOLI/7-117,((FAS_YEAST/189-297,O75013_SCHPO/132-232),FAS_PNECA/163-276)),((FOLB_HAEIN/4-114,FOLB_ECOLI/4-114),((O75013_SCHPO/8-120,FAS_PNECA/41-152),FAS_YEAST/64-178))),Q9ZJB0_HELPJ/7-113),(SULD_STRPN/4-117,(FOLB_METEX/5-118,((FOLB_MYCTU/5-117,FOLB_SYNY3/4-116),(FOLB_STRPY/4-117,FOLB_BACSU/4-117))))),FOLB_CHLPN/9-124,FOLB_CHLTR/6-121);
ATL  16.8248
DNO  17
DLN  354
DID  0.380689
DPH  (((Q9ZJB0_HELPJ/7-113:1.01835,FOLX_ECOLI/7-117:0.46990):0.14938,((FOLB_ECOLI/4-114:0.35138,FOLB_HAEIN/4-114:0.21194):0.20826,(((FAS_PNECA/41-152:0.32198,O75013_SCHPO/8-120:0.72627):0.22576,FAS_YEAST/64-178:0.41544):0.28946,(((FOLB_CHLTR/6-121:0.20171,FOLB_CHLPN/9-124:0.34136):0.50496,((FOLB_METEX/5-118:0.38121,FOLB_MYCTU/5-117:0.33271):0.33591,(FOLB_BACSU/4-117:0.32653,FOLB_STRPY/4-117:0.44788):0.04719):0.15292):0.11476,SULD_STRPN/4-117:0.53616):0.15026):0.06129):0.16124):0.21140,(FAS_PNECA/163-276:0.32121,O75013_SCHPO/132-232:0.56871):0.09398,FAS_YEAST/189-297:0.63581);
DTP  (((Q9ZJB0_HELPJ/7-113,FOLX_ECOLI/7-117),((FOLB_ECOLI/4-114,FOLB_HAEIN/4-114),(((FAS_PNECA/41-152,O75013_SCHPO/8-120),FAS_YEAST/64-178),(((FOLB_CHLTR/6-121,FOLB_CHLPN/9-124),((FOLB_METEX/5-118,FOLB_MYCTU/5-117),(FOLB_BACSU/4-117,FOLB_STRPY/4-117))),SULD_STRPN/4-117)))),(FAS_PNECA/163-276,O75013_SCHPO/132-232),FAS_YEAST/189-297);
DTL  10.3153
RID  0.229529
RPH  (((((((O75013_SCHPO/8-120:1.21386,FAS_PNECA/41-152:0.53357):0.40946,FAS_YEAST/64-178:0.69704):0.44478,(FOLB_HAEIN/4-114:0.30476,FOLB_ECOLI/4-114:0.26580):0.36637):0.13849,(((FAS_YEAST/189-297:1.06999,O75013_SCHPO/132-232:0.67207):0.24441,FAS_PNECA/163-276:0.53980):0.35279,FOLX_ECOLI/7-117:0.82220):0.22732):0.07223,Q9ZJB0_HELPJ/7-113:1.76247):0.32283,(SULD_STRPN/4-117:0.99145,((FOLB_MYCTU/5-117:0.72425,(FOLB_STRPY/4-117:0.71610,FOLB_BACSU/4-117:0.34989):0.21977):0.09934,FOLB_METEX/5-118:0.61973):0.09267):0.13693):0.87207,FOLB_CHLPN/9-124:0.42205,FOLB_CHLTR/6-121:0.36014);
RTP  (((((((O75013_SCHPO/8-120,FAS_PNECA/41-152),FAS_YEAST/64-178),(FOLB_HAEIN/4-114,FOLB_ECOLI/4-114)),(((FAS_YEAST/189-297,O75013_SCHPO/132-232),FAS_PNECA/163-276),FOLX_ECOLI/7-117)),Q9ZJB0_HELPJ/7-113),(SULD_STRPN/4-117,((FOLB_MYCTU/5-117,(FOLB_STRPY/4-117,FOLB_BACSU/4-117)),FOLB_METEX/5-118))),FOLB_CHLPN/9-124,FOLB_CHLTR/6-121);
RTL  16.1743
LNK  FAS_PNECA/163-276:P29251:M86602
LNK  FAS_PNECA/41-152:P29251:M86602
LNK  FAS_YEAST/189-297:P53848:X96722
LNK  FAS_YEAST/64-178:P53848:X96722
LNK  FOLB_BACSU/4-117:P28823:M34053
LNK  FOLB_CHLPN/9-124:Q9Z7E9:AE001657
LNK  FOLB_CHLTR/6-121:O84620:AE001331
LNK  FOLB_ECOLI/4-114:P31055:AE016988
LNK  FOLB_HAEIN/4-114:P46362:U32712
LNK  FOLB_METEX/5-118:P71513:U72662
LNK  FOLB_MYCTU/5-117:O06275:BX842583
LNK  FOLB_STRPY/4-117:O33725:AE006553
LNK  FOLB_SYNY3/4-116:P74342:
LNK  FOLX_ECOLI/7-117:P80449:X96709
LNK  O75013_SCHPO/132-232:O75013:AL031856
LNK  O75013_SCHPO/8-120:O75013:AL031856
LNK  Q9ZJB0_HELPJ/7-113:Q9ZJB0:AE001562
LNK  SULD_STRPN/4-117:P22291:AE007342
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  FAS_YEAST/189-297
ASQ  VRISELKMLTLIGVFTFERLKKQYVTLDIKLPWP--KKAELP------PPVQSIIDNVVKFVEESN.FKTVEALVESVSAVIAHNEYFQKFPDSPLVVKVLKLNAITATEGVGVSCIR
DSQ  GTTAGGATATCTGAGTTAAAAATGTTGACTTTGATTGGTGTTTTCACCTTTGAGAGACTTAAGAAACAGTATGTAACTTTGGATATAAAGTTGCCTTGGCCA------AAGAAAGCCGAATTGCCA------------------CCGCCAGTGCAAAGCATAATTGATAACGTTGTCAAGTTTGTGGAGGAATCAAAT...TTCAAGACTGTGGAAGCTCTTGTAGAATCTGTGTCAGCTGTTATTGCCCATAACGAGTATTTTCAAAAGTTTCCAGATTCGCCTTTGGTGGTGAAGGTTTTGAAATTAAACGCAATCACAGCCACAGAAGGTGTTGGTGTAAGCTGTATTAGA
TRN  10010101110011000
NAM  O75013_SCHPO/132-232
ASQ  IEFSDLELATILGIHAFERQEKQRVCLNISFANT-------------EVEALEIARAIAEYVEQSA.FLTIEALVVNLSKYLCFTK---NLDDISIKAEKPSAITFANASAVQIYRTR
DSQ  ATTGAATTCTCGGATTTGGAGTTAGCTACGATATTAGGAATTCACGCATTTGAACGACAAGAGAAGCAAAGAGTTTGCTTAAATATATCATTTGCAAATACG---------------------------------------GAGGTCGAAGCTTTAGAGATCGCGCGCGCAATCGCCGAATATGTCGAACAATCTGCT...TTCCTGACTATAGAAGCTTTGGTTGTCAATCTTTCAAAGTATCTTTGTTTTACAAAG---------AATCTAGACGATATAAGCATTAAAGCTGAGAAACCTAGTGCTATCACATTCGCCAATGCTTCTGCGGTGCAAATTTATCGAACACGG
TRN  10010101100011000
NAM  FAS_PNECA/163-276
ASQ  FFIKNLSLYTIIGINPEERVNKQNIIIDLILFKSSINLECKDDFIINTYNIEKLLKEIVKHVEEST.FKTIEALALSIARISCISH---NIEKIIVKVKKSCALAFAESAGVEIVRSR
DSQ  TTTTTTATAAAGAACTTAAGTCTTTATACAATTATAGGTATAAACCCAGAAGAGAGGGTTAATAAACAGAATATTATTATTGATTTAATATTGTTCAAGTCATCTATAAATTTAGAATGTAAAGATGATTTTATTATAAATACATATAATATTGAAAAATTACTGAAAGAGATTGTTAAACATGTAGAGGAATCGACT...TTTAAAACTATAGAAGCTCTTGCGTTGTCTATAGCAAGAATTTCATGTATATCACAT---------AATATTGAAAAAATAATAGTCAAAGTGAAGAAATCTTGTGCTCTTGCTTTTGCTGAATCAGCTGGTGTTGAAATTGTTAGGTCTCGT
TRN  10010101100011000
NAM  FOLX_ECOLI/7-117
ASQ  IRIKNLRLRTFIGIKEEEINNRQDIVINVTIHYP-ADKARTSEDINDALNYRTVTKNIIQHVENNR.FSLLEKLTQDVLDIAREHH---WVTYAEVEIDKLHALRYADSVSMTLSW--
DSQ  ATTCGTATAAAGAACCTTCGTTTGCGTACGTTTATCGGAATTAAGGAAGAAGAAATTAACAACCGTCAGGATATTGTTATCAATGTGACGATCCACTACCCC---GCCGATAAAGCGCGCACTAGCGAAGATATCAACGATGCGCTGAATTATCGCACCGTAACGAAAAACATTATTCAGCATGTGGAGAATAACCGT...TTCTCTTTGCTGGAAAAATTAACTCAGGATGTGCTCGATATCGCACGTGAACATCAC---------TGGGTGACGTATGCTGAAGTGGAGATCGATAAACTGCACGCGCTGCGCTACGCCGATTCGGTATCCATGACCTTAAGCTGG------
TRN  10010101100011010
NAM  FOLB_ECOLI/4-114
ASQ  VFIEQLSVITTIGVYDWEQTIEQKLVFDIEMAWD-NRKAAKSDDVADCLSYADIAETVVSHVEGAR.FALVERVAEEVAELLLARF---NSPWVRIKLSKPGAVARAANVGVIIER--
DSQ  GTATTTATAGAGCAACTTTCGGTAATCACCACTATTGGTGTTTACGACTGGGAACAGACCATCGAACAGAAGTTAGTGTTCGATATCGAAATGGCATGGGAT---AACCGTAAAGCGGCGAAAAGTGATGATGTGGCGGATTGCCTCAGTTACGCTGACATTGCAGAAACGGTGGTCAGCCACGTCGAGGGGGCGCGT...TTTGCGCTGGTGGAACGCGTGGCTGAAGAGGTGGCGGAGCTGCTGTTAGCACGCTTC---------AACTCGCCGTGGGTGCGTATCAAACTCAGCAAGCCAGGCGCAGTGGCGCGGGCGGCGAATGTTGGCGTAATCATTGAGCGT------
TRN  10010101100011010
NAM  FOLB_HAEIN/4-114
ASQ  VFIEELTVFAQIGVYDWEQQIKQKLVFDLEMAWD-CKQAAETDDVVYCLNYAEVSQAIIDYVESKP.FLLIERVAYEVADLLESRY---QLQGLKIKLSKPKAVAQARNVGVLIVR--
DSQ  GTTTTTATTGAAGAATTGACTGTTTTTGCACAAATCGGTGTATATGATTGGGAACAGCAAATAAAGCAAAAACTTGTGTTTGATTTGGAAATGGCTTGGGAT---TGCAAACAAGCGGCAGAAACGGATGATGTTGTATATTGTTTAAATTATGCTGAAGTGAGTCAAGCGATTATTGATTATGTGGAAAGCAAACCT...TTCTTGCTGATTGAGCGAGTGGCTTATGAAGTGGCGGATTTGCTTGAGTCACGTTAT---------CAACTTCAAGGATTAAAAATTAAACTGAGTAAACCAAAAGCCGTCGCTCAAGCTCGAAATGTTGGCGTATTGATTGTTCGT------
TRN  10010101100011000
NAM  FOLB_BACSU/4-117
ASQ  VYVEGMEFYGYHGVFTEENKLGQRFKVDLTAELD-LSKAGQTDDLEQTINYAELYHVCKDIVEGEP.VKLVETLAERIAGTVLGKFQ--PVQQCTVKVIKPDPPIPGHYKSVAIEITR
DSQ  GTTTATGTAGAAGGTATGGAGTTTTACGGATATCACGGTGTGTTCACAGAAGAAAACAAACTTGGCCAGCGGTTTAAAGTCGATTTAACCGCTGAGCTGGAT---TTAAGCAAAGCTGGACAGACAGACGACCTTGAGCAAACGATCAACTATGCTGAGCTCTATCACGTATGTAAAGATATCGTGGAAGGGGAGCCT...GTGAAATTGGTGGAAACGCTGGCGGAACGTATTGCTGGCACTGTTCTCGGAAAATTTCAG------CCTGTTCAGCAATGTACGGTGAAAGTGATTAAGCCAGACCCGCCAATTCCCGGACACTATAAATCAGTAGCAATTGAAATTACGAGA
TRN  10010101100011000
NAM  FOLB_SYNY3/4-116
ASQ  LNVKGIRAYGYTGYFDAEQFLGQWFEVDLTIWID-LAKAGQSDDLNDTLNYADAVAIVQKLIRESK.FKMIEKLAEAIADAILGTG---KTQQVKVALTKCQAPIPDFDGDVTLEILR
NAM  FOLB_STRPY/4-117
ASQ  IVLEGCRFYGYHGAFKEEQTLGQIFLVDLELSVD-LQAASLSDQLTDTVHYGMVFDSVRQLVEGEK.FILIERLAGAICEQLFNEFP--PIEAIKVAIKKENPPIAGHYKAVGIELER
DSQ  ATCGTATTAGAAGGTTGCCGTTTTTATGGCTACCATGGAGCCTTTAAAGAAGAACAGACCCTTGGGCAAATTTTTCTGGTTGATTTAGAATTGTCAGTCGAT---TTGCAAGCAGCTTCTTTGTCAGACCAATTAACAGATACGGTCCATTACGGGATGGTGTTTGATAGTGTCCGTCAGTTAGTGGAAGGGGAAAAG...TTTATTTTGATTGAACGTTTAGCAGGTGCGATTTGTGAACAGCTTTTTAACGAATTTCCG------CCTATTGAAGCCATCAAAGTGGCCATTAAAAAGGAAAACCCACCGATTGCAGGCCACTATAAGGCAGTTGGTATTGAATTGGAGAGA
TRN  10010101100011000
NAM  FOLB_METEX/5-118
ASQ  ILVHRLAVFARHGVLPEEERLGQRFYISLECRLD-LAPAGRSDDVAATVSYADLAEIALEIASNRR.FALIEALAEAIAETCLARFP--RIETIAVRIDKPSAPIPAVLDYAAIEIVR
DSQ  ATCCTCGTCCACCGCCTCGCGGTCTTCGCCCGTCACGGAGTGCTGCCGGAGGAGGAGCGGCTCGGCCAGCGCTTCTACATCTCGTTGGAATGCCGGCTCGAC---CTCGCACCGGCCGGCCGCAGCGACGACGTGGCCGCCACCGTGAGCTACGCGGATCTCGCCGAGATCGCACTGGAGATCGCCTCCAACCGGCGC...TTCGCCCTGATCGAAGCGCTGGCCGAGGCGATCGCCGAGACCTGCCTCGCGCGGTTTCCC------CGGATCGAGACGATCGCGGTGCGGATCGACAAGCCGAGCGCGCCGATCCCGGCCGTGCTCGACTACGCGGCCATCGAGATCGTGCGG
TRN  11011111101111111
NAM  FOLB_MYCTU/5-117
ASQ  IELRGLTVHGRHGVYDHERVAGQRFVIDVTVWID-LAEAANSDDLADTYDYVRLASRAAEIVAGPP.RKLIETVGAEIADHVMDDQ---RVHAVEVAVHKPQAPIPQTFDDVAVVIRR
DSQ  ATCGAACTGCGCGGCCTGACCGTGCATGGTCGGCACGGGGTCTACGACCACGAGCGAGTGGCCGGGCAGCGGTTTGTCATCGATGTCACCGTGTGGATAGAC---CTGGCCGAGGCCGCCAACAGCGACGACTTGGCCGACACCTATGACTACGTGCGGCTGGCTTCGCGGGCGGCCGAGATCGTCGCCGGACCCCCG...CGGAAGCTGATCGAAACGGTCGGGGCCGAGATCGCTGATCACGTGATGGACGACCAG---------CGAGTGCATGCCGTTGAGGTGGCGGTACACAAGCCGCAGGCGCCCATTCCGCAGACGTTCGACGATGTGGCGGTGGTGATCCGACGC
TRN  10010111100111011
NAM  SULD_STRPN/4-117
ASQ  LQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYD-MTKAATDLDLTASVHYGELCQQWTTWFQETS.EDLIETVAYKLVERTFEFYP--LVQEMKLELKKPWAPVHLSLDTCSVTIHR
DSQ  CTGCAGATTAAGGATTTGGAAATGTTTGCCTATCATGGTCTTTTTCCTAGTGAGAAAGAATTGGGGCAGAAATTTGTCGTTTCAGCCATCCTATCCTATGAT---ATGACCAAGGCAGCTACAGACTTGGATTTAACAGCCTCTGTCCATTACGGAGAATTGTGTCAGCAGTGGACGACTTGGTTTCAGGAAACGAGT...GAAGATTTGATTGAAACGGTAGCCTATAAACTGGTGGAACGTACCTTTGAGTTTTATCCT------CTTGTCCAAGAAATGAAGTTGGAACTGAAAAAACCTTGGGCACCGGTGCATTTGTCACTAGATACTTGCTCGGTAACCATTCATCGC
TRN  11011101101011000
NAM  FOLB_CHLTR/6-121
ASQ  LDIADFRVWVSIGVSEQERHYPQPVLVSLSLFFKEEPKACSTDKVSDSVCYAELVSLIEEVATNNP.CALIERLAKVLLEKIEKALAG-QVSRIDLRVSKERPPIPDLLSPVSFSISR
DSQ  TTAGATATAGCGGATTTTCGCGTTTGGGTATCTATAGGAGTCTCAGAACAAGAACGGCATTATCCGCAGCCCGTTCTTGTTTCTTTATCTCTTTTTTTTAAAGAAGAGCCAAAGGCTTGTTCCACGGACAAAGTCTCTGATAGCGTGTGTTATGCAGAGCTTGTTTCTCTTATTGAAGAAGTTGCAACGAATAATCCT...TGTGCTTTAATTGAACGTTTAGCTAAGGTTTTGCTGGAAAAAATAGAAAAGGCTTTGGCTGGA---CAAGTTTCTAGGATTGACTTGCGAGTAAGTAAAGAGCGTCCTCCGATCCCAGATCTACTCAGTCCTGTAAGTTTCAGCATAAGTAGA
TRN  10010101100011000
NAM  FOLB_CHLPN/9-124
ASQ  LIISKFRMWLFLGCSVEERHFKQPVLISVTFSYNEVPSACLSDKLSDACCYLEVTSLIEEIANTKP.YALIEHLANELFDSLVISFGD-KASKIDLEVEKERPPVPNLLNPIKFTISK
DSQ  TTAATTATATCCAAGTTTCGTATGTGGTTGTTTTTAGGGTGTTCTGTTGAAGAGCGTCATTTTAAGCAGCCTGTTCTTATTTCAGTGACTTTTTCTTATAACGAAGTCCCGTCTGCTTGTTTATCCGACAAGCTTTCAGATGCTTGTTGTTATCTAGAGGTCACCTCTCTTATTGAAGAGATTGCGAATACAAAGCCT...TATGCTTTAATAGAGCACCTGGCTAACGAGCTATTTGATAGCTTAGTGATATCTTTTGGAGAT---AAAGCCTCCAAGATAGATCTAGAGGTAGAAAAAGAACGGCCACCTGTTCCCAACCTATTAAATCCTATAAAATTTACAATTAGTAAA
TRN  10010101100011000
NAM  FAS_PNECA/41-152
ASQ  IHIHSLTLKSIVGKNSWAQRLLQPVVLTLSMGIN-ASLSGNMDDLSYSIDYATVYKEVFKLVENSK.FENLLDLSDKISKVVLGDK--CKGNWVKVIAETPKGHLLAETGLQIIRR--
DSQ  ATTCATATTCATTCATTAACTTTGAAATCTATTGTAGGAAAGAATTCGTGGGCTCAAAGATTGCTACAACCAGTTGTACTTACACTTAGTATGGGAATCAAT---GCTTCTTTGTCTGGAAACATGGACGATTTATCTTATTCTATAGATTATGCAACAGTTTATAAAGAAGTTTTTAAATTGGTTGAAAATTCTAAA...TTTGAAAATCTACTAGACTTATCTGATAAGATTTCCAAAGTTGTTCTTGGAGATAAG------TGCAAAGGGAATTGGGTTAAAGTTATAGCGGAAACGCCTAAAGGACATTTGTTAGCAGAAACCGGATTACAAATTATAAGAAGA------
TRN  10010101110011000
NAM  O75013_SCHPO/8-120
ASQ  VVVENLNTFAVVGQDQWKRKEPQPVQIDVYMRNN-VQLAGEKDELKSTIHYGIASKLLRKEIEGSF.FTTPKDLVNKIASLCFEDVI--DTSHVSIKLTLPKCVLRSKNGLHYYAER-
DSQ  GTCGTAGTTGAAAATCTTAACACATTTGCTGTAGTGGGTCAAGACCAATGGAAAAGAAAGGAACCTCAGCCAGTGCAAATTGATGTATATATGAGAAACAAT---GTTCAGTTAGCTGGAGAAAAAGACGAGTTAAAATCAACGATTCATTACGGTATAGCTTCTAAGCTATTACGAAAAGAAATTGAAGGGTCTTTT...TTTACAACCCCTAAAGATTTGGTCAATAAAATTGCAAGTTTATGTTTTGAAGACGTTATT------GATACCTCGCATGTTTCTATTAAGCTTACTTTACCCAAATGTGTTTTAAGGTCTAAAAATGGATTGCACTATTATGCTGAGCGC---
TRN  10010101110011000
NAM  FAS_YEAST/64-178
ASQ  VHIKKLEMNTVLGPDSWNQLMPQKCLLSLDMGTD-FSKSAATDDLKYSLNYAVISRDLTNFVSKKKnWGSVSNLAKSVSQFVMDKYS--GVECLNLEVQADTTHIRSDHISCIIQQER
DSQ  GTGCACATTAAGAAACTAGAGATGAATACAGTTCTTGGGCCTGATTCCTGGAATCAATTAATGCCTCAGAAATGTCTACTAAGCTTAGATATGGGTACAGAT---TTTAGTAAATCTGCGGCTACGGATGATTTGAAATATTCTCTAAATTATGCAGTTATTTCTCGTGATTTGACGAATTTCGTCAGCAAAAAAAAGaatTGGGGTTCTGTTTCTAATTTGGCTAAATCTGTGTCTCAATTTGTTATGGACAAATATTCT------GGTGTCGAGTGTCTGAATTTAGAAGTGCAGGCGGATACAACGCATATTAGAAGTGACCACATATCTTGTATTATTCAACAAGAAAGA
TRN  10010101100011010
NAM  Q9ZJB0_HELPJ/7-113
ASQ  VHIHNLVFETILGILEFERLKPQKISVDLDLFYT-ELPNKAY------LDYMEIQEIIQNTMREKQ.YLLIEDALKDLSQILKTRY---KKISELFLKISKLEISPNSQVGASMKIYY
DSQ  GTCCATATCCATAACTTGGTGTTTGAAACGATTTTAGGGATTTTAGAGTTTGAACGCTTAAAACCCCAAAAAATAAGCGTGGATTTGGATCTTTTCTACACG---GAATTACCCAATAAGGCTTAT------------------TTGGACTACATGGAAATCCAAGAAATCATTCAAAACACCATGCGAGAAAAACAA...TACCTTCTCATTGAAGACGCCTTGAAAGATTTGAGCCAAATTTTAAAAACGCGCTAC---------AAGAAAATCTCTGAGCTTTTTTTGAAAATCAGCAAGTTAGAAATTTCTCCCAATTCTCAAGTGGGGGCGAGCATGAAAATTTACTAT
TRN  10010101110011010
//