EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02149 - KA1)
FAM  PF02149
PID  KA1
DES  Kinase associated domain 1
IPR  IPR001772
ANO  11
ALN  50
AID  0.368061
APH  (((((O81992_HORVU/464-512:0.32881,Q43475_HORVU/435-483:0.11998):0.00000,((KIN10_ARATH/486-534:0.00000,O04122_SOLTU/465-513:0.18290):0.06048,(P92958_ARATH/463-511:0.23407,Q41485_SOLTU/454-502:0.49626):0.01050):0.07947):1.26879,MELK_HUMAN/602-651:1.10975):0.20247,(KIN1_SCHPO/842-891:0.26032,KIN1_YEAST/1015-1064:0.42530):0.21653):0.37037,O45370_CAEEL/93-142:0.44710,O08678_RAT/744-793:0.12400);
ATP  (((((O81992_HORVU/464-512,Q43475_HORVU/435-483),((KIN10_ARATH/486-534,O04122_SOLTU/465-513),(P92958_ARATH/463-511,Q41485_SOLTU/454-502))),MELK_HUMAN/602-651),(KIN1_SCHPO/842-891,KIN1_YEAST/1015-1064)),O45370_CAEEL/93-142,O08678_RAT/744-793);
ATL  5.95058
DNO  11
DLN  150
DID  0.471438
DPH  ((((((Q41485_SOLTU/454-502:0.26212,O04122_SOLTU/465-513:0.14529):0.05200,(P92958_ARATH/463-511:0.20061,KIN10_ARATH/486-534:0.14250):0.02994):0.07000,O81992_HORVU/464-512:0.23332):0.10335,Q43475_HORVU/435-483:0.10077):0.70214,(MELK_HUMAN/602-651:0.91135,(KIN1_SCHPO/842-891:0.45051,KIN1_YEAST/1015-1064:0.34202):0.08273):0.09682):0.27848,O45370_CAEEL/93-142:0.30596,O08678_RAT/744-793:0.25103);
DTP  ((((((Q41485_SOLTU/454-502,O04122_SOLTU/465-513),(P92958_ARATH/463-511,KIN10_ARATH/486-534)),O81992_HORVU/464-512),Q43475_HORVU/435-483),(MELK_HUMAN/602-651,(KIN1_SCHPO/842-891,KIN1_YEAST/1015-1064))),O45370_CAEEL/93-142,O08678_RAT/744-793);
DTL  4.77778
RID  0.368061
RPH  (((((O81992_HORVU/464-512:0.32881,Q43475_HORVU/435-483:0.11998):0.00000,((KIN10_ARATH/486-534:0.00000,O04122_SOLTU/465-513:0.18290):0.06048,(P92958_ARATH/463-511:0.23407,Q41485_SOLTU/454-502:0.49626):0.01050):0.07947):1.26879,MELK_HUMAN/602-651:1.10975):0.20247,(KIN1_SCHPO/842-891:0.26032,KIN1_YEAST/1015-1064:0.42530):0.21653):0.37037,O45370_CAEEL/93-142:0.44710,O08678_RAT/744-793:0.12400);
RTP  (((((O81992_HORVU/464-512,Q43475_HORVU/435-483),((KIN10_ARATH/486-534,O04122_SOLTU/465-513),(P92958_ARATH/463-511,Q41485_SOLTU/454-502))),MELK_HUMAN/602-651),(KIN1_SCHPO/842-891,KIN1_YEAST/1015-1064)),O45370_CAEEL/93-142,O08678_RAT/744-793);
RTL  5.95058
LNK  KIN10_ARATH/486-534:Q38997:AY093170
LNK  KIN1_SCHPO/842-891:P22987:M64999
LNK  KIN1_YEAST/1015-1064:P13185:M69017
LNK  MELK_HUMAN/602-651:Q14680:BC014039
LNK  O04122_SOLTU/465-513:O04122:U83797
LNK  O08678_RAT/744-793:O08678:Z83868
LNK  O45370_CAEEL/93-142:O45370:Z83105
LNK  O81992_HORVU/464-512:O81992:AJ007990
LNK  P92958_ARATH/463-511:P92958:X99279
LNK  Q41485_SOLTU/454-502:Q41485:X95997
LNK  Q43475_HORVU/435-483:Q43475:X82548
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q43475_HORVU/435-483
ASQ  GDKSTHIVKFEIQLYKT-RGDKYLLDLQRVSGPQLLFLDLCSAFLTQLRV
DSQ  GGTGACAAATCAACCCACATCGTGAAGTTTGAAATTCAGCTGTACAAAACA---AGGGGTGATAAGTATCTTCTCGACTTGCAAAGGGTTAGTGGACCACAGCTCCTCTTTCTGGACCTGTGTTCTGCCTTTCTAACCCAGCTGAGAGTC
TRN  10010101100011001
NAM  O04122_SOLTU/465-513
ASQ  DTKLTNVVKFEVQLYKT-REEKYLLDLQRIQGPQFLFLDLCAAFLAQLRV
DSQ  GACACAAAATTAACAAATGTGGTCAAGTTTGAAGTTCAGCTTTACAAAACC---AGGGAGGAGAAGTACTTACTTGACCTTCAGAGGATTCAGGGTCCACAGTTCCTCTTCCTGGATCTCTGTGCTGCTTTTCTTGCTCAGCTTCGCGTA
TRN  10010101100011010
NAM  KIN10_ARATH/486-534
ASQ  AVKSPNVVKFEIQLYKT-RDDKYLLDLQRVQGPQFLFLDLCAAFLAQLRV
DSQ  GCTGTTAAGTCGCCCAATGTTGTCAAGTTTGAAATTCAGTTGTATAAAACT---CGGGACGACAAGTATCTACTGGATTTGCAGAGAGTACAAGGTCCTCAGTTCTTGTTCTTGGATCTGTGTGCTGCTTTTCTTGCTCAGCTCCGAGTC
TRN  10010101100011011
NAM  P92958_ARATH/463-511
ASQ  AMTSPTVIKFELQLYKA-REEKYLLDIQRVNGPQFLFLDLCAAFLTELRV
DSQ  GCCATGACTTCACCCACTGTCATCAAATTTGAACTTCAGCTATACAAAGCC---CGGGAAGAGAAGTACTTGCTGGATATACAGAGAGTTAACGGTCCGCAGTTTCTCTTCTTGGATCTATGCGCCGCCTTTCTTACAGAGCTTCGTGTG
TRN  10010101100011001
NAM  O81992_HORVU/464-512
ASQ  DGRLPAVVKFEIQLYKT-KDNKYLLDIQRVTGPQLLFLEFCGAFLTNLRV
DSQ  GATGGGAGGCTACCCGCCGTAGTCAAGTTTGAAATCCAGCTTTACAAGACC---AAGGATAACAAGTACCTGCTAGATATCCAGAGAGTTACTGGACCTCAGCTCCTTTTCCTGGAATTTTGTGGGGCGTTCCTTACCAACCTTAGGGTT
TRN  10010101100011011
NAM  Q41485_SOLTU/454-502
ASQ  HLQPQPTVKFEMQLYKT-EDEKYLLDLQRISGPQFLFLDFCAGFIRQLEG
DSQ  CATTTACAGCCACAACCTACTGTGAAGTTTGAAATGCAGCTGTACAAAACT---GAGGATGAAAAATACCTACTTGATCTCCAAAGAATTAGCGGTCCGCAGTTCCTCTTCCTGGATTTCTGTGCTGGTTTCATTAGGCAGCTAGAGGGA
TRN  10010101100011010
NAM  KIN1_YEAST/1015-1064
ASQ  TTTEKEPIKFEIHIVKVRIVGLAGVHFKKISGNTWLYKELASSILKELKL
DSQ  ACTACAACAGAAAAAGAGCCCATCAAATTCGAAATTCATATCGTCAAGGTTCGTATTGTTGGTTTAGCCGGTGTGCATTTTAAGAAAATTTCTGGGAACACTTGGTTGTATAAAGAGCTGGCTTCTAGTATATTAAAAGAACTAAAGTTG
TRN  10010101100011010
NAM  KIN1_SCHPO/842-891
ASQ  GESPASNLAFEIYIVKVPILSLRGVSFHRISGNSWQYKTLASRILNELKL
DSQ  GGTGAGTCGCCTGCCTCTAACCTTGCCTTTGAAATATATATTGTGAAAGTCCCTATACTCTCTCTTCGTGGCGTTTCTTTTCATCGAATTAGTGGAAACTCATGGCAATATAAGACATTGGCTAGTCGTATTCTTAACGAATTAAAATTG
TRN  10010101110011000
NAM  O08678_RAT/744-793
ASQ  DARQDSLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL
DSQ  GACGCTCGGCAGGACAGCCTCGTACAGTGGGAGATGGAGGTCTGCAAGTTGCCTCGGCTCTCACTCAATGGGGTCCGCTTCAAGCGAATATCCGGGACATCTATTGCCTTTAAGAACATTGCATCCAAAATAGCAAATGAGCTTAAGCTG
TRN  10010101100011001
NAM  O45370_CAEEL/93-142
ASQ  DPLTDASVKWDIEVCTLPRLYLNGVHFQRISGSSSDFKNITTKISEELDI
DSQ  GATCCTCTCACTGATGCTTCAGTAAAGTGGGATATCGAGGTCTGCACACTACCACGCTTGTATTTGAATGGAGTTCATTTTCAACGAATTTCGGGAAGCTCGAGCGACTTCAAGAACATTACTACGAAAATATCGGAAGAGCTTGATATT
TRN  10010101110011001
NAM  MELK_HUMAN/602-651
ASQ  SDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV
DSQ  TCAGATTTTGGGAAAGTGACAATGCAATTTGAATTAGAAGTGTGCCAGCTTCAAAAACCCGATGTGGTGGGTATCAGGAGGCAGCGGCTTAAGGGCGATGCCTGGGTTTACAAAAGATTAGTGGAAGACATCCTATCTAGCTGCAAGGTA
TRN  10010101110011000
//