EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02128 - Peptidase_M36)
FAM  PF02128
PID  Peptidase_M36
DES  Fungalysin metallopeptidase (M36)
IPR  IPR001842
ANO  2
ALN  389
AID  0.813031
APH  (Q9UVW4_ASPOR/246-634:0.18209,ELM1_ASPFU/246-634:0.05102);
ATP  (Q9UVW4_ASPOR/246-634,ELM1_ASPFU/246-634);
ATL  0.2331
DNO  2
DLN  1167
DID  0.748929
DPH  (Q9UVW4_ASPOR/246-634:0.12455,ELM1_ASPFU/246-634:0.18508);
DTP  (Q9UVW4_ASPOR/246-634,ELM1_ASPFU/246-634);
DTL  0.30963
RID  0.813031
RPH  (Q9UVW4_ASPOR/246-634:0.18209,ELM1_ASPFU/246-634:0.05102);
RTP  (Q9UVW4_ASPOR/246-634,ELM1_ASPFU/246-634);
RTL  0.2331
LNK  ELM1_ASPFU/246-634:P46074:L29566
LNK  Q9UVW4_ASPOR/246-634:Q9UVW4:AF099904
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9UVW4_ASPOR/246-634
ASQ  ADYQVYAWGINDPTEGPRTVISDPWDSSASAFTWISDGENNYTTTRGNNGIAQSNPTGGSQYLKNYRPDSPDLKFQYPYSLNATPPESYIDASITQLFYTANTYHDLLYTSGFNEEAGNFQYDNNGKGGAGNDYVILNAQDGSGTNNANFATPPDGQPGRMRMYIWTESQPYRDGSFEAGIVIHEYTHGLSNRLTGGPANSRCLNALESGGMGEGWGDFMATAIRLKAGDTHSTDYTMGEWAANKKGGIRAYPFSTSLETNPLTYTSLNELDEVHAIGAVWANVLYELLWNLIDKHGKNDGPKPEFKDGVPTDGKYLAMKLVIDGMALQPCNPNCVQARDAILDADKALTDGANKCEIWKAFAKRGLGEGAEYHASRRVGSDKVPSDAC
DSQ  GCAGATTACCAAGTATATGCATGGGGTATTAATGATCCCACGGAGGGCCCTCGCACCGTCATCAGCGATCCATGGGATTCGTCCGCATCTGCTTTCACCTGGATCAGTGACGGAGAAAACAACTATACCACAACTCGCGGCAACAACGGTATCGCACAGTCGAACCCTACCGGTGGATCGCAGTACTTGAAGAACTACCGGCCTGATAGCCCCGATTTGAAATTCCAATACCCCTATTCGCTCAACGCCACACCCCCAGAGTCCTATATTGATGCGTCTATCACTCAGCTTTTCTACACTGCCAACACGTACCACGACCTACTCTACACTTCGGGCTTCAACGAGGAGGCCGGTAATTTCCAGTACGATAACAATGGAAAAGGAGGTGCTGGAAACGACTACGTGATCCTCAATGCTCAGGACGGTTCTGGCACCAATAACGCCAACTTCGCTACGCCCCCGGATGGACAGCCCGGCCGCATGCGCATGTACATTTGGACCGAGTCCCAGCCTTACCGTGACGGCTCTTTCGAGGCTGGTATTGTGATTCACGAGTATACTCACGGTCTTTCTAACCGGCTCACTGGAGGACCTGCTAACTCTCGCTGCTTGAATGCCCTTGAATCCGGCGGAATGGGTGAAGGTTGGGGAGACTTCATGGCCACGGCAATTCGGCTCAAGGCCGGCGATACTCACTCGACCGATTATACCATGGGTGAATGGGCTGCAAACAAGAAAGGTGGCATCCGTGCTTACCCATTCTCAACCTCCCTGGAGACCAACCCTCTCACCTACACCAGTCTCAATGAATTGGACGAAGTGCATGCCATCGGCGCGGTGTGGGCTAACGTATTGTACGAGCTGTTGTGGAACTTGATCGATAAGCACGGCAAGAATGACGGGCCAAAGCCCGAGTTCAAGGATGGAGTTCCGACTGACGGCAAGTATCTCGCCATGAAGCTGGTGATTGATGGCATGGCATTGCAACCTTGCAACCCCAACTGTGTCCAGGCTCGCGACGCCATCCTCGATGCCGATAAGGCTCTCACCGATGGTGCTAACAAGTGCGAGATTTGGAAGGCGTTTGCTAAGCGTGGTTTGGGTGAAGGCGCTGAATACCATGCGTCTCGTCGGGTGGGCAGTGATAAGGTGCCCTCTGATGCTTGC
TRN  11011101101011001
NAM  ELM1_ASPFU/246-634
ASQ  ADYQVYAWGINDPTEGERTVIKDPWDSVASEFTWISDGSTNYTTSRGNNGIAQSNPSGGSSYLNNYRPSSSSLSFKYPYSVSSSPPSSYIDASIIQLFYTANIYHDLLYTLGFTEKAGNFEYNTNGQGGLGNDYVILNAQDGSGTNNANFATPPDGQPGRMRMYVWTESTPYRNGSFEAGIVIHEYTHGLSNRLTGGPANSNSLYALESGGMGEGWSDFMATAIRLKPGDKRSTDYAMGEWASNRAGGIRQYPYSTSLSTNPLTYTSVNSLNAVHAIGTVWASILYEVLWNLIDKHGKNDAPKPTLRDGVPTDGKYLAMKLVMDGMAFQPCNANFVQARDAILDADTALTGGENQCEIWTAFAKRGLGAGAKYSSRNRVGSTEVPSGVC
DSQ  GCCGACTACCAAGTATACGCATGGGGCATTAATGACCCAACAGAGGGCGAGCGGACGGTGATCAAGGATCCTTGGGACTCGGTCGCGTCGGAATTCACCTGGATCAGTGATGGCAGCACAAATTATACCACTTCGCGCGGCAACAACGGCATCGCGCAATCCAATCCCAGCGGTGGGTCGAGCTACCTGAACAACTACCGCCCTAGCAGCTCGAGCCTGTCATTCAAGTATCCCTATAGTGTGAGCTCGTCGCCGCCATCATCCTACATCGACGCATCGATCATCCAGCTCTTCTACACGGCCAATATCTACCATGATCTGCTTTACACCCTGGGCTTCACCGAAAAGGCCGGTAACTTCGAGTACAACACTAACGGGCAAGGCGGCCTGGGTAATGACTATGTCATCCTGAACGCCCAGGACGGCTCTGGCACCAACAACGCCAACTTTGCCACTCCTCCTGATGGTCAGCCCGGCCGCATGCGCATGTACGTCTGGACCGAGTCGACGCCGTACCGCAACGGCTCCTTTGAGGCTGGAATCGTGATCCACGAGTATACTCACGGTCTTTCCAACCGACTCACTGGCGGGCCTGCCAACTCCAACTCTCTGTACGCCCTCGAGTCAGGCGGCATGGGCGAAGGCTGGAGTGATTTCATGGCGACGGCCATCCGTCTGAAGCCCGGCGACAAGCGCTCGACCGACTACGCCATGGGCGAATGGGCTTCCAACCGGGCAGGCGGAATCCGCCAGTACCCGTACTCGACCTCGCTGAGCACCAACCCTCTAACGTACACCAGCGTCAACTCGCTGAACGCGGTGCACGCCATTGGCACGGTCTGGGCATCCATTCTGTACGAGGTGTTGTGGAATTTGATCGATAAGCACGGCAAGAATGATGCGCCGAAGCCTACCCTGCGCGATGGGGTGCCGACGGACGGCAAGTACCTTGCCATGAAACTAGTCATGGATGGGATGGCATTCCAACCATGCAACGCCAACTTTGTCCAGGCCCGTGACGCCATCCTGGATGCTGATACTGCTCTGACTGGTGGCGAGAACCAGTGTGAGATTTGGACGGCATTTGCCAAGCGGGGATTGGGTGCTGGGGCGAAGTATAGCTCAAGGAACCGGGTGGGAAGTACTGAGGTCCCCAGTGGTGTCTGT
TRN  10010101100011001
//